PhosR is a package for the comprehensive analysis of
phosphoproteomic data. There are two major components to PhosR:
processing and downstream analysis. PhosR consists of various processing
tools for phosphoproteomic data including filtering, imputation,
normalisaton and batch correction, enabling integration of multiple
phosphoproteomic datasets. Downstream analytical tools consists of site-
and protein-centric pathway analysis to evaluate activities of kinases
and signalling pathways, large-scale kinase-substrate annotation from
dynamic phosphoproteomic profiling, and visualisation and construction
of signalomes present in the phosphoproteomic data of interest.
Below is a schematic overview of main componenets of PhosR, categorised into two broad steps of data analytics - processing and downstream analysis.
The purpose of this vignette is to illustrate some uses of
PhosR and explain its key components.
Install the latest development version from GitHub using the
devtools package:
To install the Bioconductor version of PhosR, enter the following to your R console.
For demonstration purposes, we provide a rat L6 myotubes phosphoproteome dataset in our package. The data contains ratios of samples treated with AICAR, an analog of adenosine monophosphate that stimulates AMPK activity, insulin (Ins), or in combination (AICAR+Ins) with the basal condition. The raw data have been deposited to the ProteomeXchange Consortium via the PRIDE partner repository under PRIDE: PXD019127.
To increase compatibility of PhosR functions with diverse processed
datasets, we have implemented a PhosphoExperiment (ppe)
object based on the SummarizedExperiment class. To create
the PhosphoExperiment object, you will need a
quantification matrix where columns refer to cells and rows refer to
sites.
data("phospho_L6_ratio")
ppe <- PhosphoExperiment(assays = list(Quantification = as.matrix(phospho.L6.ratio)))## Warning in .se_to_pe(se, UniprotID, GeneSymbol, Site, Residue, Sequence, : GeneSymbol is not specified. This may affect subsequent analysis steps.
## Warning in .se_to_pe(se, UniprotID, GeneSymbol, Site, Residue, Sequence, : Site is not specified. This may affect subsequent analysis steps.
## Warning in .se_to_pe(se, UniprotID, GeneSymbol, Site, Residue, Sequence, : Sequence is not specified. This may affect subsequent analysis steps.
## Warning in .se_to_pe(se, UniprotID, GeneSymbol, Site, Residue, Sequence, : Residue is not specified. This may affect subsequent analysis steps.
## [1] "PhosphoExperiment"
## attr(,"package")
## [1] "PhosR"
Additional annotation labels for the sites should be provided alongside the matrix. For each phosphosite, these include gene symbol, residue, position of phosphosite residue in the amino acid chain, and flanking sequence information of the phosphosite. Additional information such as the localisation probability may also be included.
GeneSymbol(ppe) <- sapply(strsplit(rownames(ppe), ";"), "[[", 2)
Residue(ppe) <- gsub("[0-9]","", sapply(strsplit(rownames(ppe), ";"), "[[", 3))
Site(ppe) <- as.numeric(gsub("[A-Z]","", sapply(strsplit(rownames(ppe), ";"), "[[", 3)))
Sequence(ppe) <- sapply(strsplit(rownames(ppe), ";"), "[[", 4)Collectively, we can set up our data as following.
ppe <- PhosphoExperiment(assays = list(Quantification = as.matrix(phospho.L6.ratio)),
Site = as.numeric(gsub("[A-Z]","", sapply(strsplit(rownames(ppe), ";"), "[[", 3))),
GeneSymbol = sapply(strsplit(rownames(ppe), ";"), "[[", 2),
Residue = gsub("[0-9]","", sapply(strsplit(rownames(ppe), ";"), "[[", 3)),
Sequence = sapply(strsplit(rownames(ppe), ";"), "[[", 4))## class: PhosphoExperiment
## dim: 6660 12
## metadata(0):
## assays(1): Quantification
## rownames(6660): Q6AYR1;TFG;S198;MSAFGLTDDQVSGPPSAPTEDRSGTPDSIAS
## D3ZRN2;MED1;T1035;STGGSKSPGSSGRCQTPPGVATPPIPKITIQ ...
## F1LYK3;LOC685707;S810;VKPPSIANLDKVNSNSLDLPSSSDTHASKVP
## G3V7U4;LMNB1;S393;RKLLEGEEERLKLSPSPSSRVTVSRASSSRS
## rowData names(0):
## colnames(12): AICAR_exp1 AICAR_exp2 ... AICARIns_exp3 AICARIns_exp4
## colData names(0):
PhosR is a package for the all-rounded analysis of
phosphoproteomic data from processing to downstream analysis. This
vignette will provide a step-by-step workflow of how PhosR can be used
to process and analyse a a panel of phosphoproteomic datasets. As one of
the first steps of data processing in phosphoproteomic analysis, we will
begin by performing filtering and imputation of phosphoproteomic data
with PhosR.
First, we will load the PhosR package. If you already haven’t done so, please install PhosR as instructed in the main page.
We assume that you will have the raw data processed using platforms frequently used for mass-spectrometry based proteomics such as MaxQuant. For demonstration purposes, we will take a parts of phosphoproteomic data generated by Humphrey et al. with accession number PXD001792. The dataset contains the phosphoproteomic quantifications of two mouse liver cell lines (Hepa1.6 and FL38B) that were treated with either PBS (mock) or insulin.
Let us load the PhosphoExperiment (ppe) object
## [1] "PhosphoExperiment"
## attr(,"package")
## [1] "PhosR"
A quick glance of the object.
## class: PhosphoExperiment
## dim: 5000 24
## metadata(0):
## assays(1): Quantification
## rownames(5000): Q7TPV4;MYBBP1A;S1321;PQSALPKKRARLSLVSRSPSLLQSGVKKRRV
## Q3UR85;MYRF;S304;PARAPSPPWPPQGPLSPGTGSLPLSIARAQT ...
## P28659-4;NA;S18;AFKLDFLPEMMVDHCSLNSSPVSKKMNGTLD
## E9Q8I9;FRY;S1380;HNIELVDSRLLLPGSSPSSPEDEVKDREGEV
## rowData names(0):
## colnames(24): Intensity.FL83B_Control_1 Intensity.FL83B_Control_2 ...
## Intensity.Hepa1.6_Ins_5 Intensity.Hepa1.6_Ins_6
## colData names(0):
We will take the grouping information from colnames of
our matrix.
For each cell line, there are two conditions (Control vs Insulin-stimulated) and 6 replicates for each condition.
## [1] "FL83B_Control" "FL83B_Control" "FL83B_Control" "FL83B_Control"
## [5] "FL83B_Control" "FL83B_Control" "FL83B_Ins" "FL83B_Ins"
## [9] "FL83B_Ins" "FL83B_Ins" "FL83B_Ins" "FL83B_Ins"
## [1] "Hepa1.6_Control" "Hepa1.6_Control" "Hepa1.6_Control" "Hepa1.6_Control"
## [5] "Hepa1.6_Control" "Hepa1.6_Control" "Hepa1.6_Ins" "Hepa1.6_Ins"
## [9] "Hepa1.6_Ins" "Hepa1.6_Ins" "Hepa1.6_Ins" "Hepa1.6_Ins"
Note that there are in total 24 samples and 5,000 phosphosites profiled.
## [1] 5000 24
Next, we will perform some filtering of phosphosites so that only
phosphosites with quantification for at least 50% of the replicates in
at least one of the conditions are retained. For this filtering step, we
use the selectGrps function. The filtering leaves us with
1,772 phosphosites.
## [1] 1772 24
selectGrps gives you the option to relax the threshold
for filtering. The filtering threshold can therefore be optimized for
each dataset.
# In cases where you have fewer replicates ( e.g.,triplicates), you may want to
# select phosphosites quantified in 70% of replicates.
ppe_filtered_v1 <- selectGrps(ppe, grps, 0.7, n=1)
dim(ppe_filtered_v1)## [1] 1330 24
We can proceed to imputation now that we have filtered for suboptimal
phosphosites. To take advantage of data structure and experimental
design, PhosR provides users with a lot of flexibility for imputation.
There are three functions for imputation:
scImpute,tInmpute, and ptImpute.
Here, we will demonstrate the use of scImpute and
ptImpute.
The scImpute function is used for site- and
condition-specific imputation. A pre-defined thereshold is used to
select phosphosites to impute. Phosphosites with missing values equal to
or greater than a predefined value will be imputed by sampling from the
empirical normal distribution constructed from the quantification values
of phosphosites from the same condition.
In the above example, only phosphosites that are quantified in more than 50% of samples from the same condition will be imputed.
We then perform paired tail-based imputation on the dataset imputed
with scImpute. Paired tail-based imputation performs
imputation of phosphosites that have missing values in all
replicates in one condition (e.g. in basal) but not in another
condition (e.g., in stimulation). This method of imputation
ensures that we do not accidentally filter phosphosites that seemingly
have low detection rate.
As for scImpute, we can set a predefined threshold to in
another condition (e.g. stimulation), the tail-based imputation
is applied to impute for the missing values in the first condition.
As for scImpute, we can set a predefined threshold to in
another condition (e.g. stimulation), the tail-based imputation
is applied to impute for the missing values in the first condition.
set.seed(123)
ppe_imputed <- ppe_imputed_tmp
ppe_imputed[,seq(6)] <- ptImpute(ppe_imputed[,seq(7,12)],
ppe_imputed[,seq(6)],
percent1 = 0.6, percent2 = 0, paired = FALSE)## idx1: 12
ppe_imputed[,seq(13,18)] <- ptImpute(ppe_imputed[,seq(19,24)],
ppe_imputed[,seq(13,18)],
percent1 = 0.6, percent2 = 0,
paired = FALSE)## idx1: 29
Lastly, we perform normalisation of the filtered and imputed phosphoproteomic data.
A useful function in PhosR is to visualize the
percentage of quantified sites before and after filtering and
imputation. The main inputs of plotQC are the
quantification matrix, sample labels (equating the column names of the
matrix), an integer indicating the panel to plot, and lastly, a color
vector. To visualize the percentage of quantified sites, use the
plotQC function and set panel = “quantify” to
visualise bar plots of samples.
p1 = plotQC(SummarizedExperiment::assay(ppe_filtered,"Quantification"),
labels=colnames(ppe_filtered),
panel = "quantify", grps = grps)
p2 = plotQC(SummarizedExperiment::assay(ppe_imputed_scaled,"scaled"),
labels=colnames(ppe_imputed_scaled), panel = "quantify", grps = grps)
ggpubr::ggarrange(p1, p2, nrow = 1)By setting panel = “dendrogram”, we can visualise the results of unsupervised hierarchical clustering of samples as a dendrogram. The dendrogram demonstrates that imputation has improved the clustering of the samples so that replicates from the same conditions cluster together.
p1 = plotQC(SummarizedExperiment::assay(ppe_filtered,"Quantification"),
labels=colnames(ppe_filtered), panel = "dendrogram",
grps = grps)
p2 = plotQC(SummarizedExperiment::assay(ppe_imputed_scaled,"scaled"),
labels=colnames(ppe_imputed_scaled),
panel = "dendrogram", grps = grps)
ggpubr::ggarrange(p1, p2, nrow = 1)## Found litedown! Enabling r-universe template
We can now move onto the next step in the PhosR
workflow: integration of datasets and batch correction.
A common but largely unaddressed challenge in phosphoproteomic data
analysis is to correct for batch effect. Without correcting for batch
effect, it is often not possible to analyze datasets in an integrative
manner. To perform data integration and batch effect correction, we
identified a set of stably phosphorylated sites (SPSs) across a panel of
phosphoproteomic datasets and, using these SPSs, implemented a wrapper
function of RUV-III from the ruv package called
RUVphospho.
Note that when the input data contains missing values, imputation should be performed before batch correction since RUV-III requires a complete data matrix. The imputed values are removed by default after normalisation but can be retained for downstream analysis if the users wish to use the imputed matrix. This vignette will provide an example of how PhosR can be used for batch correction.
If you haven’t already done so, load the PhosR package.
In this example, we will use L6 myotube phosphoproteome dataset (with
accession number PXD019127) and the SPSs we identified from a panel of
phosphoproteomic datasets (please refer to our
preprint for the full list of the datasets used). The
SPSs will be used as our negative control in
RUV normalisation.
## class: PhosphoExperiment
## dim: 6654 12
## metadata(0):
## assays(1): Quantification
## rownames(6654): D3ZNS8;AAAS;S495;THIPLYFVNAQFPRFSPVLGRAQEPPAGGGG
## Q9R0Z7;AAGAB;S210;RSVGSAESCQCEQEPSPTAERTESLPGHRSG ...
## D3ZG78;ZZEF1;S1516;SGPSAAEVSTAEEPSSPSTPTRRPPFTRGRL
## D3ZG78;ZZEF1;S1535;PTRRPPFTRGRLRLLSFRSMEETRPVPTVKE
## rowData names(0):
## colnames(12): AICAR_exp1 AICAR_exp2 ... AICARIns_exp3 AICARIns_exp4
## colData names(0):
The L6 myotube data contains phosphoproteomic samples from three treatment conditions each with quadruplicates. Myotube cells were treated with either AICAR or Insulin (Ins), which are both important modulators of the insulin signalling pathway, or both (AICARIns) before phosphoproteomic analysis.
## [1] "AICAR_exp1" "AICAR_exp2" "AICAR_exp3" "AICAR_exp4"
## [1] "Ins_exp1" "Ins_exp2" "Ins_exp3" "Ins_exp4"
## [1] "AICARIns_exp1" "AICARIns_exp2" "AICARIns_exp3" "AICARIns_exp4"
Note that we have in total 6654 quantified phosphosites and 12 samples in total.
## [1] 6654 12
We have already performed the relevant processing steps to generate a
dense matrix. Please refer to the imputation page to
perform filtering and imputation of phosphosites in order to generate a
matrix without any missing values.
## [1] 0
We will extract phosphosite labels.
sites = paste(sapply(GeneSymbol(ppe), function(x)x),";",
sapply(Residue(ppe), function(x)x),
sapply(Site(ppe), function(x)x),
";", sep = "")Lastly, we will take the grouping information from
colnames of our matrix.
## [1] "AICAR" "AICAR" "AICAR" "AICAR" "Ins" "Ins"
## [7] "Ins" "Ins" "AICARIns" "AICARIns" "AICARIns" "AICARIns"
There are a number of ways to diagnose batch effect. In
PhosR, we make use of two visualisation methods to detect
batch effect: dendrogram of hierarchical clustering and a principal
component analysis (PCA) plot. We use the plotQC function
we introduced in the imputation section of the vignette.
By setting panel = “dendrogram”, we can plot the dendrogram illustrating the results of unsupervised hierarchical clustering of our 12 samples. Clustering results of the samples demonstrate that there is a strong batch effect (where batch denoted as expX, where X refers to the batch number). This is particularly evident for samples from Ins and AICARIns treated conditions.
plotQC(SummarizedExperiment::assay(ppe,"Quantification"), panel = "dendrogram",
grps=grps, labels = colnames(ppe)) +
ggplot2::ggtitle("Before batch correction")We can also visualise the samples in PCA space by setting panel = “pca”. The PCA plot demonstrates aggregation of samples by batch rather than treatment groups (each point represents a sample coloured by treatment condition). It has become clearer that even within the AICAR treated samples, there is some degree of batch effect as data points are separated between samples from batches 1 and 2 and those from batches 3 and 4.
plotQC(SummarizedExperiment::assay(ppe,"Quantification"), grps=grps,
labels = colnames(ppe), panel = "pca") +
ggplot2::ggtitle("Before batch correction")We have now diagnosed that our dataset exhibits batch effect that is
driven by experiment runs for samples treated with three different
conditions. To address this batch effect, we correct for this unwanted
variation in the data by utilising our pre-defined SPSs as a negative
control for RUVphospho.
First, we construct a design matrix by condition.
## grpsAICAR grpsAICARIns grpsIns
## 1 1 0 0
## 2 1 0 0
## 3 1 0 0
## 4 1 0 0
## 5 0 0 1
## 6 0 0 1
## 7 0 0 1
## 8 0 0 1
## 9 0 1 0
## 10 0 1 0
## 11 0 1 0
## 12 0 1 0
## attr(,"assign")
## [1] 1 1 1
## attr(,"contrasts")
## attr(,"contrasts")$grps
## [1] "contr.treatment"
We will then use the RUVphospho function to normalise
the data. Besides the quantification matrix and the design matrix, there
are two other important inputs to RUVphospho: 1) the
ctl argument is an integer vector denoting the position of SPSs
within the quantification matrix 2) k parameter is an integer
denoting the expected number of experimental (e.g., treatment)
groups within the data
As quality control, we will demonstrate and evaluate our
normalisation method with hierarchical clustering and PCA plot using
again plotQC. Both the hierarchical clustering and PCA
results demonstrate the normalisation procedure in PhosR
facilitates effective batch correction.
# plot after batch correction
p1 = plotQC(SummarizedExperiment::assay(ppe, "Quantification"), grps=grps,
labels = colnames(ppe), panel = "dendrogram" )
p2 = plotQC(SummarizedExperiment::assay(ppe, "normalised"), grps=grps,
labels = colnames(ppe), panel="dendrogram")
ggpubr::ggarrange(p1, p2, nrow = 1)# plot after batch correction
p1 = plotQC(SummarizedExperiment::assay(ppe, "Quantification"), panel = "pca",
grps=grps, labels = colnames(ppe)) +
ggplot2::ggtitle("Before Batch correction")
p2 = plotQC(SummarizedExperiment::assay(ppe, "normalised"), grps=grps,
labels = colnames(ppe), panel="pca") +
ggplot2::ggtitle("After Batch correction")
ggpubr::ggarrange(p1, p2, nrow = 2)We note that the current SPS are derived from
phosphoproteomic datasets derived from mouse cells. To enable users
working on phosphoproteomic datasets derived from other species, we have
developed a function getSPS that takes in multiple
phosphoproteomics datasets stored as phosphoExperiment objects to
generate set of SPS. Users can use their in-house or public
datasets derived from the same speciies to generate species-specific
SPS, which they can use to normalise their data.Below
demonstrate the usage of the getSPS function.
First, load datasets to use for SPS generation.
data("phospho_L6_ratio_pe")
data("phospho.liver.Ins.TC.ratio.RUV.pe")
data("phospho.cells.Ins.pe")
ppe1 <- phospho.L6.ratio.pe
ppe2 <- phospho.liver.Ins.TC.ratio.RUV.pe
# ppe2 <- phospho.L1.Ins.ratio.subset.pe
ppe3 <- phospho.cells.Ins.peFilter, impute, and transform ppe3 (other inputs have already been processed).
grp3 = gsub('_[0-9]{1}', '', colnames(ppe3))
ppe3 <- selectGrps(ppe3, grps = grp3, 0.5, n=1)
ppe3 <- tImpute(ppe3)
FL83B.ratio <- SummarizedExperiment::assay(ppe3, "imputed")[, 1:12] -
rowMeans(SummarizedExperiment::assay(ppe3, "imputed")[,grep("FL83B_Control",
colnames(ppe3))])
Hepa.ratio <- SummarizedExperiment::assay(ppe3,"imputed")[, 13:24] -
rowMeans(SummarizedExperiment::assay(ppe3,"imputed")[,grep("Hepa1.6_Control",
colnames(ppe3))])
SummarizedExperiment::assay(ppe3, "Quantification") <-
cbind(FL83B.ratio, Hepa.ratio)Generate inputs of getSPS.
ppe.list <- list(ppe1, ppe2, ppe3)
# ppe.list <- list(ppe1, ppe3)
cond.list <- list(grp1 = gsub("_.+", "", colnames(ppe1)),
grp2 = str_sub(colnames(ppe2), end=-5),
grp3 = str_sub(colnames(ppe3), end=-3))Finally run getSPS to generate list of SPSs.
## Warning: there aren't enough overlappling sites
## [1] "TMPO;S67;" "RBM5;S621;" "SRRM1;S427;" "THOC2;S1417;" "SSB;S92;"
## [6] "PPIG;S252;"
Run RUVphospho using the newly generateed SPSs.
(NOTE that we do not expect the results to be
reproducible as the exempler SPSs have been generated from dummy
datasets that have been heavily filtered.)
Most phosphoproteomic studies have adopted a phosphosite-level
analysis of the data. To enable phosphoproteomic data analysis at the
gene level, PhosR implements both site- and gene-centric
analyses for detecting changes in kinase activities and signalling
pathways through traditional enrichment analyses (over-representation or
rank-based gene set test, together referred to as‘1-dimensional
enrichment analysis’) as well as 2- and 3-dimensional analyses.
This vignette will perform gene-centric pathway enrichment analyses
on the normalised myotube phosphoproteomic dataset using both
over-representation and rank–based gene set tests and also provide an
example of how directPA can be used to test which kinases
are activated upon different stimulations in myotubes using
2-dimensional analyses Yang
et al. 2014.
First, we will load the PhosR package with few other packages will use for the demonstration purpose.
We will use RUV normalised L6 phosphopreteome data for demonstration of gene-centric pathway analysis. It contains phosphoproteome from three different treatment conditions: (1) AMPK agonist AICAR, (2) insulin (Ins), and (3) in combination (AICAR+Ins).
suppressPackageStartupMessages({
library(calibrate)
library(limma)
library(directPA)
library(org.Rn.eg.db)
library(reactome.db)
library(annotate)
library(PhosR)
})We will use the ppe_RUV matrix from batch_correction.
To enable enrichment analyses on both gene and phosphosite levels,
PhosR implements a simple method called phosCollapse which
reduces phosphosite level of information to the proteins for performing
downstream gene-centric analyses. We will utilise two functions,
pathwayOverrepresent and
pathwayRankBasedEnrichment, to demonstrate 1-dimensional
(over-representation and rank-based gene set test) gene-centric pathway
enrichment analysis respectively.
First, extract phosphosite information from the ppe object.
sites = paste(sapply(GeneSymbol(ppe), function(x)x),";",
sapply(Residue(ppe), function(x)x),
sapply(Site(ppe), function(x)x),
";", sep = "")Then fit a linear model for each phosphosite.
f <- gsub("_exp\\d", "", colnames(ppe))
X <- model.matrix(~ f - 1)
fit <- lmFit(SummarizedExperiment::assay(ppe, "normalised"), X)Extract top-differentially regulated phosphosites for each condition compared to basal.
table.AICAR <- topTable(eBayes(fit), number=Inf, coef = 1)
table.Ins <- topTable(eBayes(fit), number=Inf, coef = 3)
table.AICARIns <- topTable(eBayes(fit), number=Inf, coef = 2)
DE1.RUV <- c(sum(table.AICAR[,"adj.P.Val"] < 0.05), sum(table.Ins[,"adj.P.Val"] < 0.05), sum(table.AICARIns[,"adj.P.Val"] < 0.05))
# extract top-ranked phosphosites for each group comparison
contrast.matrix1 <- makeContrasts(fAICARIns-fIns, levels=X) # defining group comparisons
contrast.matrix2 <- makeContrasts(fAICARIns-fAICAR, levels=X) # defining group comparisons
fit1 <- contrasts.fit(fit, contrast.matrix1)
fit2 <- contrasts.fit(fit, contrast.matrix2)
table.AICARInsVSIns <- topTable(eBayes(fit1), number=Inf)
table.AICARInsVSAICAR <- topTable(eBayes(fit2), number=Inf)
DE2.RUV <- c(sum(table.AICARInsVSIns[,"adj.P.Val"] < 0.05), sum(table.AICARInsVSAICAR[,"adj.P.Val"] < 0.05))
o <- rownames(table.AICARInsVSIns)
Tc <- cbind(table.Ins[o,"logFC"], table.AICAR[o,"logFC"], table.AICARIns[o,"logFC"])
rownames(Tc) <- sites[match(o, rownames(ppe))]
rownames(Tc) <- gsub("(.*)(;[A-Z])([0-9]+)(;)", "\\1;\\3;", rownames(Tc))
colnames(Tc) <- c("Ins", "AICAR", "AICAR+Ins")Summarize phosphosite-level information to proteins for the downstream gene-centric analysis.
Tc.gene <- phosCollapse(Tc, id=gsub(";.+", "", rownames(Tc)),
stat=apply(abs(Tc), 1, max), by = "max")
geneSet <- names(sort(Tc.gene[,1],
decreasing = TRUE))[seq(round(nrow(Tc.gene) * 0.1))]
head(geneSet)## [1] "PPP1R13L" "SYNPO2L" "AHNAK" "USP10" "SENP7" "ATG2A"
pathways = as.list(reactomePATHID2EXTID)
path_names = as.list(reactomePATHID2NAME)
name_id = match(names(pathways), names(path_names))
names(pathways) = unlist(path_names)[name_id]
pathways = pathways[which(grepl("Rattus norvegicus", names(pathways), ignore.case = TRUE))]
pathways = lapply(pathways, function(path) {
gene_name = unname(getSYMBOL(path, data = "org.Rn.eg"))
toupper(unique(gene_name))
})path1 <- pathwayOverrepresent(geneSet, annotation=pathways,
universe = rownames(Tc.gene), alter = "greater")
path2 <- pathwayRankBasedEnrichment(Tc.gene[,1],
annotation=pathways,
alter = "greater")Next, we will compare enrichment of pathways (in negative log10 p-values) between the two 1-dimensional pathway enrichment analysis. On the scatter plot, the x-axis and y-axis refer to the p-values derived from the rank-based gene set test and over-representation test, respectively. We find several expected pathways, while these highly enriched pathways are largely in agreement between the two types of enrichment analyses.
lp1 <- -log10(as.numeric(path2[names(pathways),1]))
lp2 <- -log10(as.numeric(path1[names(pathways),1]))
plot(lp1, lp2, ylab="Overrepresentation (-log10 pvalue)", xlab="Rank-based enrichment (-log10 pvalue)", main="Comparison of 1D pathway analyses", xlim = c(0, 10))
# select highly enriched pathways
sel <- which(lp1 > 1.5 & lp2 > 0.9)
textxy(lp1[sel], lp2[sel], gsub("_", " ", gsub("REACTOME_", "", names(pathways)))[sel])One key aspect in studying signalling pathways is to identify key
kinases that are involved in signalling cascades. To identify these
kinases, we make use of kinase-substrate annotation databases such as
PhosphoSitePlus and Phospho.ELM. These
databases are included in the PhosR and
directPA packages already. To access them, simply load the
package and access the data by data(“PhosphoSitePlus”) and
data(“PhosphoELM”).
The 2- and 3-dimensional analyses enable the investigation of kinases
regulated by different combinations of treatments. We will introduce
more advanced methods implemented in the R package directPA
for performing “2 and 3-dimentional” direction site-centric kinase
activity analyses.
# 2D direction site-centric kinase activity analyses
par(mfrow=c(1,2))
dpa1 <- directPA(Tc[,c(1,3)], direction=0,
annotation=lapply(PhosphoSite.rat, function(x){gsub(";[STY]", ";", x)}),
main="Direction pathway analysis")
dpa2 <- directPA(Tc[,c(1,3)], direction=pi*7/4,
annotation=lapply(PhosphoSite.rat, function(x){gsub(";[STY]", ";", x)}),
main="Direction pathway analysis")## pvalue size
## AKT1 6.207001e-09 9
## MAPK1 0.00057404 9
## PRKACA 0.0006825021 25
## PRKAA1 0.000965093 6
## MAPK3 0.006670176 10
## pvalue size
## PRKAA1 0.00463462 6
## AKT1 0.02942273 9
## CSNK2A1 0.2193148 12
## CDK5 0.2607434 5
## MAPK1 0.2767886 9
There is also a function called perturbPlot2d
implemented in kinasePA for testing and visualising
activity of all kinases on all possible directions. Below are the
demonstration from using this function.
z1 <- perturbPlot2d(Tc=Tc[,c(1,2)],
annotation=lapply(PhosphoSite.rat, function(x){gsub(";[STY]", ";", x)}),
cex=1, xlim=c(-2, 4), ylim=c(-2, 4),
main="Kinase perturbation analysis")z2 <- perturbPlot2d(Tc=Tc[,c(1,3)], annotation=lapply(PhosphoSite.rat, function(x){gsub(";[STY]", ";", x)}),
cex=1, xlim=c(-2, 4), ylim=c(-2, 4),
main="Kinase perturbation analysis")z3 <- perturbPlot2d(Tc=Tc[,c(2,3)], annotation=lapply(PhosphoSite.rat, function(x){gsub(";[STY]", ";", x)}),
cex=1, xlim=c(-2, 4), ylim=c(-2, 4),
main="Kinase perturbation analysis")While 1, 2, and 3D pathway analyses are useful for data generated from experiments with different treatment/conditions, analysis designed for time-course data may be better suited to analysis experiments that profile multiple time points.
Here, we will apply ClueR which is an R package
specifically designed for time-course proteomic and phosphoproteomic
data analysis Yang
et al. 2015.
We will load the PhosR package with few other packages we will use for this tutorial.
suppressPackageStartupMessages({
library(parallel)
library(ggplot2)
library(ClueR)
library(reactome.db)
library(org.Mm.eg.db)
library(annotate)
library(PhosR)
})We will load a dataset integrated from two time-course datasets of early and intermediate insulin signalling in mouse liver upon insulin stimulation to demonstrate the time-course phosphoproteomic data analyses.
# data("phospho_liverInsTC_RUV_pe")
data("phospho.liver.Ins.TC.ratio.RUV.pe")
ppe <- phospho.liver.Ins.TC.ratio.RUV.pe
ppe## class: PhosphoExperiment
## dim: 800 90
## metadata(0):
## assays(1): Quantification
## rownames(800): LARP7;256; SRSF10;131; ... SIK3;493; GSK3A;21;
## rowData names(0):
## colnames(90): Intensity.Liver_Ins_0s_Bio7 Intensity.Liver_Ins_0s_Bio8
## ... Intensity.Liver_Ins_10m_Bio5 Intensity.Liver_Ins_10m_Bio6
## colData names(0):
Let us start with gene-centric analysis. Such analysis can be
directly applied to proteomics data. It can also be applied to
phosphoproteomic data by using the phosCollapse function to
summarise phosphosite information to proteins.
# take grouping information
grps <- sapply(strsplit(colnames(ppe), "_"),
function(x)x[3])
# select differentially phosphorylated sites
sites.p <- matANOVA(SummarizedExperiment::assay(ppe, "Quantification"),
grps)
ppm <- meanAbundance(SummarizedExperiment::assay(ppe, "Quantification"), grps)
sel <- which((sites.p < 0.05) & (rowSums(abs(ppm) > 1) != 0))
ppm_filtered <- ppm[sel,]
# summarise phosphosites information into gene level
ppm_gene <- phosCollapse(ppm_filtered,
gsub(";.+", "", rownames(ppm_filtered)),
stat = apply(abs(ppm_filtered), 1, max), by = "max")
# perform ClueR to identify optimal number of clusters
pathways = as.list(reactomePATHID2EXTID)
pathways = pathways[which(grepl("R-MMU", names(pathways), ignore.case = TRUE))]
pathways = lapply(pathways, function(path) {
gene_name = unname(getSYMBOL(path, data = "org.Mm.eg"))
toupper(unique(gene_name))
})
RNGkind("L'Ecuyer-CMRG")
set.seed(123)
c1 <- runClue(ppm_gene, annotation=pathways,
kRange = seq(2,10), rep = 5, effectiveSize = c(5, 100),
pvalueCutoff = 0.05, alpha = 0.5)
# Visualise the evaluation results
data <- data.frame(Success=as.numeric(c1$evlMat), Freq=rep(seq(2,10), each=5))
myplot <- ggplot(data, aes(x=Freq, y=Success)) +
geom_boxplot(aes(x = factor(Freq), fill="gray")) +
stat_smooth(method="loess", colour="red", size=3, span = 0.5) +
xlab("# of cluster") +
ylab("Enrichment score") +
theme_classic()## Warning: Using `size` aesthetic for lines was deprecated in ggplot2 3.4.0.
## ℹ Please use `linewidth` instead.
## This warning is displayed once per session.
## Call `lifecycle::last_lifecycle_warnings()` to see where this warning was
## generated.
## `geom_smooth()` using formula = 'y ~ x'
Phosphosite-centric analyses will perform using kinase-substrate annotation information from PhosphoSitePlus.
RNGkind("L'Ecuyer-CMRG")
set.seed(1)
PhosphoSite.mouse2 = mapply(function(kinase) {
gsub("(.*)(;[A-Z])([0-9]+;)", "\\1;\\3", kinase)
}, PhosphoSite.mouse)
# perform ClueR to identify optimal number of clusters
c3 <- runClue(ppm_filtered, annotation=PhosphoSite.mouse2, kRange = 2:10, rep = 5, effectiveSize = c(5, 100), pvalueCutoff = 0.05, alpha = 0.5)
# Visualise the evaluation results
data <- data.frame(Success=as.numeric(c3$evlMat), Freq=rep(2:10, each=5))
myplot <- ggplot(data, aes(x=Freq, y=Success)) + geom_boxplot(aes(x = factor(Freq), fill="gray"))+
stat_smooth(method="loess", colour="red", size=3, span = 0.5) + xlab("# of cluster")+ ylab("Enrichment score")+theme_classic()
myplot## `geom_smooth()` using formula = 'y ~ x'
## size
## [1,] "PRKACA" "0.000184676866298047" "5"
## substrates
## [1,] "NR1H3;196;|MARCKS;163;|PRKACA;339;|ITPR1;1755;|SIK3;493;"
##
## $`cluster 3`
## kinase pvalue size
## [1,] "Humphrey.Akt" "0.000162969329853963" "5"
## [2,] "Yang.Akt" "0.000165386907010959" "6"
## substrates
## [1,] "TSC2;939;|PFKFB2;486;|FOXO3;252;|FOXO1;316;|GSK3A;21;"
## [2,] "AKT1S1;247;|TSC2;939;|PFKFB2;486;|FOXO3;252;|FOXO1;316;|GSK3A;21;"
Lastly, a key component of the PhosR package is to
construct signalomes. The signalome construction is composed of two main
steps: 1) kinase-substrate relationsip scoring and 2) signalome
construction. This involves a sequential workflow where the outputs of
the first step are used as inputs of the latter step.
In brief, our kinase-substrate relationship scoring method
(kinaseSubstrateScore and kinaseSubstratePred)
prioritises potential kinases that could be responsible for the
phosphorylation change of phosphosite on the basis of kinase recognition
motif and phosphoproteomic dynamics. Using the kinase-substrate
relationships derived from the scoring methods, we reconstruct signalome
networks present in the data (Signalomes) wherin we
highlight kinase regulation of discrete modules.
##3 Loading packages and data
First, we will load the PhosR package along with few
other packages that we will be using in this section of the
vignette.
suppressPackageStartupMessages({
library(PhosR)
library(dplyr)
library(ggplot2)
library(GGally)
library(ggpubr)
library(calibrate)
library(network)
})We will also be needing data containing kinase-substrate annotations
from PhosphoSitePlus, kinase recognition motifs from
kinase motifs, and annotations of kinase families from
kinase family.
data("KinaseMotifs")
data("KinaseFamily")
data("phospho_L6_ratio_pe")
data("SPSs")
ppe = phospho.L6.ratio.pe
sites = paste(sapply(GeneSymbol(ppe), function(x)x),";",
sapply(Residue(ppe), function(x)x),
sapply(Site(ppe), function(x)x),
";", sep = "")
grps = gsub("_.+", "", colnames(ppe))
design = model.matrix(~ grps - 1)
ctl = which(sites %in% SPSs)
ppe = RUVphospho(ppe, M = design, k = 3, ctl = ctl)As before, we will set up the data by cleaning up the phoshophosite
labels and performing RUV normalisation. We will generate the
ppe_RUV matrix as in batch_correction.
data("phospho_L6_ratio")
data("SPSs")
##### Run batch correction
ppe <- phospho.L6.ratio.pe
sites = paste(sapply(GeneSymbol(ppe), function(x)x),";",
sapply(Residue(ppe), function(x)x),
sapply(Site(ppe), function(x)x),
";", sep = "")
grps = gsub("_.+", "", colnames(ppe))
design = model.matrix(~ grps - 1)
ctl = which(sites %in% SPSs)
ppe = RUVphospho(ppe, M = design, k = 3, ctl = ctl)
phosphoL6 = SummarizedExperiment::assay(ppe, "normalised")Next, we will filtered for dynamically regulated phosphosites and then standardise the filtered matrix.
# filter for up-regulated phosphosites
phosphoL6.mean <- meanAbundance(phosphoL6, grps = gsub("_.+", "", colnames(phosphoL6)))
aov <- matANOVA(mat=phosphoL6, grps=gsub("_.+", "", colnames(phosphoL6)))
idx <- (aov < 0.05) & (rowSums(phosphoL6.mean > 0.5) > 0)
phosphoL6.reg <- phosphoL6[idx, ,drop = FALSE]
L6.phos.std <- standardise(phosphoL6.reg)
rownames(L6.phos.std) <- paste0(GeneSymbol(ppe), ";", Residue(ppe), Site(ppe), ";")[idx]We next extract the kinase recognition motifs from each phosphosite.
Now that we have all the inputs for kinaseSubstrateScore
and kinaseSubstratePred ready, we can proceed to the
generation of kinase-substrate relationship scores.
L6.matrices <- kinaseSubstrateScore(substrate.list = PhosphoSite.mouse,
mat = L6.phos.std, seqs = L6.phos.seq,
numMotif = 5, numSub = 1, verbose = FALSE)The signalome construction uses the outputs of
kinaseSubstrateScore and kinaseSubstratePred
functions for the generation of a visualisation of the kinase regulation
of discrete regulatory protein modules present in our phosphoproteomic
data.
kinaseOI = c("PRKAA1", "AKT1")
Signalomes_results <- Signalomes(KSR=L6.matrices,
predMatrix=L6.predMat,
exprsMat=L6.phos.std,
KOI=kinaseOI)## calculating optimal number of clusters...
## optimal number of clusters = 3
We can also visualise the relative contribution of each kinase towards the regulation of protein modules by plotting a balloon plot. In the balloon plot, the size of the balloons denote the percentage magnitude of kinase regulation in each module.
### generate palette
my_color_palette <- grDevices::colorRampPalette(RColorBrewer::brewer.pal(8, "Accent"))
kinase_all_color <- my_color_palette(ncol(L6.matrices$combinedScoreMatrix))
names(kinase_all_color) <- colnames(L6.matrices$combinedScoreMatrix)
kinase_signalome_color <- kinase_all_color[colnames(L6.predMat)]
plotSignalomeMap(signalomes = Signalomes_results, color = kinase_signalome_color)## R version 4.6.1 (2026-06-24)
## Platform: x86_64-pc-linux-gnu
## Running under: Ubuntu 26.04 LTS
##
## Matrix products: default
## BLAS: /usr/lib/x86_64-linux-gnu/openblas-pthread/libblas.so.3
## LAPACK: /usr/lib/x86_64-linux-gnu/openblas-pthread/libopenblasp-r0.3.32.so; LAPACK version 3.12.0
##
## Random number generation:
## RNG: L'Ecuyer-CMRG
## Normal: Inversion
## Sample: Rejection
##
## locale:
## [1] LC_CTYPE=en_US.UTF-8 LC_NUMERIC=C
## [3] LC_TIME=en_US.UTF-8 LC_COLLATE=en_US.UTF-8
## [5] LC_MONETARY=en_US.UTF-8 LC_MESSAGES=en_US.UTF-8
## [7] LC_PAPER=en_US.UTF-8 LC_NAME=C
## [9] LC_ADDRESS=C LC_TELEPHONE=C
## [11] LC_MEASUREMENT=en_US.UTF-8 LC_IDENTIFICATION=C
##
## time zone: Etc/UTC
## tzcode source: system (glibc)
##
## attached base packages:
## [1] parallel stats4 stats graphics grDevices utils datasets
## [8] methods base
##
## other attached packages:
## [1] network_1.20.0 ggpubr_0.6.3 GGally_2.4.0
## [4] dplyr_1.2.1 org.Mm.eg.db_3.23.0 ClueR_1.4.2
## [7] annotate_1.90.0 XML_3.99-0.23 reactome.db_1.96.0
## [10] org.Rn.eg.db_3.23.0 AnnotationDbi_1.74.0 IRanges_2.46.0
## [13] S4Vectors_0.50.1 Biobase_2.72.0 BiocGenerics_0.58.1
## [16] generics_0.1.4 directPA_1.5.1 limma_3.68.4
## [19] calibrate_1.7.7 MASS_7.3-65 ggplot2_4.0.3
## [22] stringr_1.6.0 PhosR_1.22.0 BiocStyle_2.40.0
##
## loaded via a namespace (and not attached):
## [1] RColorBrewer_1.1-3 ggdendro_0.2.0
## [3] sys_3.4.3 jsonlite_2.0.0
## [5] shape_1.4.6.1 magrittr_2.0.5
## [7] farver_2.1.2 rmarkdown_2.31
## [9] GlobalOptions_0.1.4 vctrs_0.7.3
## [11] memoise_2.0.1 rstatix_0.7.3
## [13] htmltools_0.5.9 S4Arrays_1.12.0
## [15] broom_1.0.13 SparseArray_1.12.2
## [17] Formula_1.2-5 sass_0.4.10
## [19] bslib_0.11.0 plyr_1.8.9
## [21] cachem_1.1.0 buildtools_1.0.0
## [23] commonmark_2.0.0 igraph_2.3.3
## [25] lifecycle_1.0.5 pkgconfig_2.0.3
## [27] Matrix_1.7-5 R6_2.6.1
## [29] fastmap_1.2.0 MatrixGenerics_1.24.0
## [31] digest_0.6.39 pcaMethods_2.4.0
## [33] colorspace_2.1-2 GenomicRanges_1.64.0
## [35] RSQLite_3.53.3 labeling_0.4.3
## [37] httr_1.4.8 abind_1.4-8
## [39] mgcv_1.9-4 compiler_4.6.1
## [41] proxy_0.4-29 bit64_4.8.2
## [43] withr_3.0.3 S7_0.2.2
## [45] backports_1.5.1 carData_3.0-6
## [47] viridis_0.6.5 DBI_1.3.0
## [49] ggstats_0.13.0 dendextend_1.19.1
## [51] ggsignif_0.6.4 DelayedArray_0.38.2
## [53] tools_4.6.1 otel_0.2.0
## [55] glue_1.8.1 nlme_3.1-169
## [57] gridtext_0.1.6 grid_4.6.1
## [59] reshape2_1.4.5 gtable_0.3.6
## [61] class_7.3-23 preprocessCore_1.74.0
## [63] tidyr_1.3.2 xml2_1.6.0
## [65] car_3.1-5 XVector_0.52.0
## [67] pillar_1.11.1 markdown_2.0
## [69] circlize_0.4.18 splines_4.6.1
## [71] ggtext_0.1.2 lattice_0.22-9
## [73] bit_4.6.0 ruv_0.9.7.1
## [75] tidyselect_1.2.1 maketools_1.3.2
## [77] Biostrings_2.80.1 knitr_1.51
## [79] gridExtra_2.3.1 litedown_0.9
## [81] Seqinfo_1.2.0 SummarizedExperiment_1.42.0
## [83] xfun_0.59 statmod_1.5.2
## [85] matrixStats_1.5.0 pheatmap_1.0.13
## [87] stringi_1.8.7 statnet.common_4.13.0
## [89] yaml_2.3.12 evaluate_1.0.5
## [91] tibble_3.3.1 BiocManager_1.30.27
## [93] cli_3.6.6 xtable_1.8-8
## [95] jquerylib_0.1.4 Rcpp_1.1.1-1.1
## [97] coda_0.19-4.1 png_0.1-9
## [99] blob_1.3.0 viridisLite_0.4.3
## [101] scales_1.4.0 e1071_1.7-17
## [103] purrr_1.2.2 crayon_1.5.3
## [105] rlang_1.2.0 cowplot_1.2.0
## [107] KEGGREST_1.52.2