| Title: | Perform pairwise sequence alignments |
|---|---|
| Description: | The two main functions in the package are pairwiseAlignment() and stringDist(). The former solves (Needleman-Wunsch) global alignment, (Smith-Waterman) local alignment, and (ends-free) overlap alignment problems. The latter computes the Levenshtein edit distance or pairwise alignment score matrix for a set of strings. |
| Authors: | Patrick Aboyoun [aut], Robert Gentleman [aut], Hervé Pagès [cre] (ORCID: <https://orcid.org/0009-0002-8272-4522>) |
| Maintainer: | Hervé Pagès <[email protected]> |
| License: | Artistic-2.0 |
| Version: | 1.8.0 |
| Built: | 2026-06-03 08:02:47 UTC |
| Source: | https://github.com/bioc/pwalign |
A variety of different functions used to deal with sequence alignments.
nedit(x) # also nmatch and nmismatch mismatchTable(x, shiftLeft=0L, shiftRight=0L, ...) mismatchSummary(x, ...) ## S4 method for signature 'AlignedXStringSet0' coverage(x, shift=0L, width=NULL, weight=1L) ## S4 method for signature 'PairwiseAlignmentsSingleSubject' coverage(x, shift=0L, width=NULL, weight=1L) compareStrings(pattern, subject) ## S4 method for signature 'PairwiseAlignmentsSingleSubject' consensusMatrix(x, as.prob=FALSE, shift=0L, width=NULL, baseOnly=FALSE, gapCode="-", endgapCode="-")nedit(x) # also nmatch and nmismatch mismatchTable(x, shiftLeft=0L, shiftRight=0L, ...) mismatchSummary(x, ...) ## S4 method for signature 'AlignedXStringSet0' coverage(x, shift=0L, width=NULL, weight=1L) ## S4 method for signature 'PairwiseAlignmentsSingleSubject' coverage(x, shift=0L, width=NULL, weight=1L) compareStrings(pattern, subject) ## S4 method for signature 'PairwiseAlignmentsSingleSubject' consensusMatrix(x, as.prob=FALSE, shift=0L, width=NULL, baseOnly=FALSE, gapCode="-", endgapCode="-")
x |
A |
shiftLeft, shiftRight
|
Non-positive and non-negative integers respectively that specify how many preceding and succeeding characters to and from the mismatch position to include in the mismatch substrings. |
... |
Further arguments to be passed to or from other methods. |
shift, width
|
See |
weight |
An integer vector specifying how much each element in |
pattern, subject
|
The strings to compare. Can be of type If the first argument of |
as.prob |
If |
baseOnly |
|
gapCode, endgapCode
|
The codes in the appropriate |
nedit(): An integer vector of the same length as the input
PairwiseAlignments object reporting the number of edits (i.e.
nb of mismatches + nb of indels) for each alignment.
mismatchTable(): A data.frame containing the positions and
substrings of the mismatches for the AlignedXStringSet or
PairwiseAlignments object.
mismatchSummary(): A list of data.frame objects containing counts and
frequencies of the mismatches for the AlignedXStringSet or
PairwiseAlignmentsSingleSubject object.
compareStrings(): Combines two equal-length strings that are assumed
to be aligned into a single character string containing that replaces
mismatches with "?", insertions with "+", and deletions with
"-".
P. Aboyoun
pairwiseAlignment,
consensusMatrix,
XString-class, XStringSet-class, XStringViews-class,
AlignedXStringSet-class, PairwiseAlignments-class,
match-utils
## Compare two globally aligned strings string1 <- "ACTTCACCAGCTCCCTGGCGGTAAGTTGATC---AAAGG---AAACGCAAAGTTTTCAAG" string2 <- "GTTTCACTACTTCCTTTCGGGTAAGTAAATATATAAATATATAAAAATATAATTTTCATC" compareStrings(string1, string2) ## Create a consensus matrix nw1 <- pairwiseAlignment( AAStringSet(c("HLDNLKGTF", "HVDDMPNAL")), AAString("SMDDTEKMSMKL"), substitutionMatrix = "BLOSUM50", gapOpening = 3, gapExtension = 1) consensusMatrix(nw1) ## Examine the consensus between the bacteriophage phi X174 genomes data(phiX174Phage) phageConsmat <- consensusMatrix(phiX174Phage, baseOnly = TRUE) phageDiffs <- which(apply(phageConsmat, 2, max) < length(phiX174Phage)) phageDiffs phageConsmat[,phageDiffs]## Compare two globally aligned strings string1 <- "ACTTCACCAGCTCCCTGGCGGTAAGTTGATC---AAAGG---AAACGCAAAGTTTTCAAG" string2 <- "GTTTCACTACTTCCTTTCGGGTAAGTAAATATATAAATATATAAAAATATAATTTTCATC" compareStrings(string1, string2) ## Create a consensus matrix nw1 <- pairwiseAlignment( AAStringSet(c("HLDNLKGTF", "HVDDMPNAL")), AAString("SMDDTEKMSMKL"), substitutionMatrix = "BLOSUM50", gapOpening = 3, gapExtension = 1) consensusMatrix(nw1) ## Examine the consensus between the bacteriophage phi X174 genomes data(phiX174Phage) phageConsmat <- consensusMatrix(phiX174Phage, baseOnly = TRUE) phageDiffs <- which(apply(phageConsmat, 2, max) < length(phiX174Phage)) phageDiffs phageConsmat[,phageDiffs]
The AlignedXStringSet and QualityAlignedXStringSet classes are
containers for storing an aligned XStringSet.
Before we define the notion of alignment, we introduce the notion of "filled-with-gaps subsequence". A "filled-with-gaps subsequence" of a string string1 is obtained by inserting 0 or any number of gaps in a subsequence of s1. For example L-A–ND and A–N-D are "filled-with-gaps subsequences" of LAND. An alignment between two strings string1 and string2 results in two strings (align1 and align2) that have the same length and are "filled-with-gaps subsequences" of string1 and string2.
For example, this is an alignment between LAND and LEAVES:
L-A
LEA
An alignment can be seen as a compact representation of one set of basic operations that transforms string1 into align1. There are 3 different kinds of basic operations: "insertions" (gaps in align1), "deletions" (gaps in align2), "replacements". The above alignment represents the following basic operations:
insert E at pos 2
insert V at pos 4
insert E at pos 5
replace by S at pos 6 (N is replaced by S)
delete at pos 7 (D is deleted)
Note that "insert X at pos i" means that all letters at a position >= i are moved 1 place to the right before X is actually inserted.
There are many possible alignments between two given strings string1 and string2 and a common problem is to find the one (or those ones) with the highest score, i.e. with the lower total cost in terms of basic operations.
In the code snippets below,
x is a AlignedXStringSet or QualityAlignedXStringSet object.
unaligned(x):The original string.
aligned(x, degap = FALSE):If degap = FALSE, the "filled-with-gaps subsequence" representing
the aligned substring. If degap = TRUE, the "gap-less subsequence"
representing the aligned substring.
ranges(x):The bounds of the aligned substring.
start(x):The start of the aligned substring.
end(x):The end of the aligned substring.
width(x):The width of the aligned substring, ignoring gaps.
indel(x):The positions, in the form of an IRanges object, of the insertions or
deletions (depending on what x represents).
nindel(x):A two-column matrix containing the length and sum of the widths for each of
the elements returned by indel.
length(x):The length of the aligned(x).
nchar(x):The nchar of the aligned(x).
alphabet(x):Equivalent to alphabet(unaligned(x)).
as.character(x):Converts aligned(x) to a character vector.
toString(x):Equivalent to toString(as.character(x)).
x[i]:Returns a new AlignedXStringSet or QualityAlignedXStringSet
object made of the selected elements.
rep(x, times):Returns a new AlignedXStringSet or QualityAlignedXStringSet
object made of the repeated elements.
P. Aboyoun
pairwiseAlignment,
PairwiseAlignments-class,
XStringSet-class
pattern <- AAString("LAND") subject <- AAString("LEAVES") pa1 <- pairwiseAlignment(pattern, subject, substitutionMatrix="BLOSUM50", gapOpening=3, gapExtension=1) alignedPattern <- pattern(pa1) class(alignedPattern) # AlignedXStringSet object unaligned(alignedPattern) aligned(alignedPattern) as.character(alignedPattern) nchar(alignedPattern)pattern <- AAString("LAND") subject <- AAString("LEAVES") pa1 <- pairwiseAlignment(pattern, subject, substitutionMatrix="BLOSUM50", gapOpening=3, gapExtension=1) alignedPattern <- pattern(pa1) class(alignedPattern) # AlignedXStringSet object unaligned(alignedPattern) aligned(alignedPattern) as.character(alignedPattern) nchar(alignedPattern)
The InDel class is a container for storing insertion and deletion
information.
This is a generic class that stores any insertion and deletion information.
In the code snippets below,
x is a InDel object.
insertion(x):The insertion information.
deletion(x):The deletion information.
P. Aboyoun
pairwiseAlignment,
PairwiseAlignments-class
pa <- PairwiseAlignments("-PA--W-HEAE", "HEAGAWGHE-E") pa_indel <- indel(pa) # an InDel object insertion(pa_indel) deletion(pa_indel)pa <- PairwiseAlignments("-PA--W-HEAE", "HEAGAWGHE-E") pa_indel <- indel(pa) # an InDel object insertion(pa_indel) deletion(pa_indel)
Solves (Needleman-Wunsch) global alignment, (Smith-Waterman) local alignment, and (ends-free) overlap alignment problems.
pairwiseAlignment(pattern, subject, ...) ## S4 method for signature 'ANY,ANY' pairwiseAlignment(pattern, subject, patternQuality=PhredQuality(22L), subjectQuality=PhredQuality(22L), type="global", substitutionMatrix=NULL, fuzzyMatrix=NULL, gapOpening=10, gapExtension=4, scoreOnly=FALSE) ## S4 method for signature 'QualityScaledXStringSet,QualityScaledXStringSet' pairwiseAlignment(pattern, subject, type="global", substitutionMatrix=NULL, fuzzyMatrix=NULL, gapOpening=10, gapExtension=4, scoreOnly=FALSE)pairwiseAlignment(pattern, subject, ...) ## S4 method for signature 'ANY,ANY' pairwiseAlignment(pattern, subject, patternQuality=PhredQuality(22L), subjectQuality=PhredQuality(22L), type="global", substitutionMatrix=NULL, fuzzyMatrix=NULL, gapOpening=10, gapExtension=4, scoreOnly=FALSE) ## S4 method for signature 'QualityScaledXStringSet,QualityScaledXStringSet' pairwiseAlignment(pattern, subject, type="global", substitutionMatrix=NULL, fuzzyMatrix=NULL, gapOpening=10, gapExtension=4, scoreOnly=FALSE)
pattern |
a character vector or |
subject |
a character vector or |
patternQuality, subjectQuality
|
objects of class
|
type |
type of alignment. One of |
substitutionMatrix |
substitution matrix representing the fixed
substitution scores for an alignment. It cannot be used in conjunction with
|
fuzzyMatrix |
fuzzy match matrix for quality-based alignments. It takes values between 0 and 1; where 0 is an unambiguous mismatch, 1 is an unambiguous match, and values in between represent a fraction of "matchiness". (See details section below.) |
gapOpening |
the cost for opening a gap in the alignment. |
gapExtension |
the incremental cost incurred along the length of the gap in the alignment. |
scoreOnly |
logical to denote whether or not to return just the scores of the optimal pairwise alignment. |
... |
optional arguments to generic function to support additional methods. |
Quality-based alignments are based on the paper the Bioinformatics article by
Ketil Malde listed in the Reference section below. Let be the
probability of an error in the base read. For "Phred" quality measures
in , these error probabilities are given by
. For "Solexa" quality measures in
, they are given by .
Assuming independence within and between base reads, the combined error
probability of a mismatch when the underlying bases do match is
,
where is the number of letters in the underlying alphabet (i.e.
for DNA input, for amino acid input, otherwise
is the number of distinct letters in the input).
Using , the substitution score is given by
,
where is the bit-scaling for the scoring and is the
probability that characters and represents the same underlying
information (e.g. using IUPAC, and .
In the arguments listed above fuzzyMatch represents
and patternQuality and subjectQuality represents
and respectively.
If scoreOnly == FALSE, a pairwise alignment with the maximum alignment
score is returned. If more than one pairwise alignment produces the maximum
alignment score, then the alignment with the smallest initial deletion whose
mismatches occur before its insertions and deletions is chosen. For example,
if pattern = "AGTA" and subject = "AACTAACTA", then the alignment
pattern: [1] AG-TA; subject: [1] AACTA is chosen over
pattern: [1] A-GTA; subject: [1] AACTA or
pattern: [1] AG-TA; subject: [5] AACTA if they all achieve the maximum
alignment score.
If scoreOnly == FALSE (the default), the function returns a
PairwiseAlignmentsSingleSubject object (if a single subject
was supplied) or a PairwiseAlignments object (if more
than one subject was supplied). In both cases, the returned object
contains N optimal pairwise alignments where N is the number of
supplied patterns, that is, N = length(pattern) if pattern
is a character vector or XStringSet derivative, or N = 1 if
it's an XString derivative. If more than one subject
was supplied, the alignments in the returned PairwiseAlignments
object are obtained by aligning pattern[[1]] to subject[[1]],
pattern[[2]] to subject[[2]], pattern[[3]] to
subject[[3]], etc...
If scoreOnly == TRUE, a numeric vector containing the scores for
the N optimal pairwise alignments is returned.
Use matchPattern or vmatchPattern if you need to
find all the occurrences (eventually with indels) of a given pattern in a
reference sequence or set of sequences.
Use matchPDict if you need to match a (big) set of patterns
against a reference sequence.
P. Aboyoun
R. Durbin, S. Eddy, A. Krogh, G. Mitchison, Biological Sequence Analysis, Cambridge UP 1998, sec 2.3.
B. Haubold, T. Wiehe, Introduction to Computational Biology, Birkhauser Verlag 2006, Chapter 2.
K. Malde, The effect of sequence quality on sequence alignment, Bioinformatics 2008 24(7):897-900.
writePairwiseAlignments,
stringDist,
PairwiseAlignments-class,
XStringQuality-class,
substitution_matrices,
matchPattern
## Nucleotide global, local, and overlap alignments s1 <- DNAString("ACTTCACCAGCTCCCTGGCGGTAAGTTGATCAAAGGAAACGCAAAGTTTTCAAG") s2 <- DNAString("GTTTCACTACTTCCTTTCGGGTAAGTAAATATATAAATATATAAAAATATAATTTTCATC") # First use a fixed substitution matrix mat <- nucleotideSubstitutionMatrix(match = 1, mismatch = -3, baseOnly = TRUE) globalAlign <- pairwiseAlignment(s1, s2, substitutionMatrix = mat, gapOpening = 5, gapExtension = 2) localAlign <- pairwiseAlignment(s1, s2, type = "local", substitutionMatrix = mat, gapOpening = 5, gapExtension = 2) overlapAlign <- pairwiseAlignment(s1, s2, type = "overlap", substitutionMatrix = mat, gapOpening = 5, gapExtension = 2) # Then use quality-based method for generating a substitution matrix pairwiseAlignment(s1, s2, patternQuality = SolexaQuality(rep(c(22L, 12L), times = c(36, 18))), subjectQuality = SolexaQuality(rep(c(22L, 12L), times = c(40, 20))), scoreOnly = TRUE) # Now assume can't distinguish between C/T and G/A pairwiseAlignment(s1, s2, patternQuality = SolexaQuality(rep(c(22L, 12L), times = c(36, 18))), subjectQuality = SolexaQuality(rep(c(22L, 12L), times = c(40, 20))), type = "local") mapping <- diag(4) dimnames(mapping) <- list(DNA_BASES, DNA_BASES) mapping["C", "T"] <- mapping["T", "C"] <- 1 mapping["G", "A"] <- mapping["A", "G"] <- 1 pairwiseAlignment(s1, s2, patternQuality = SolexaQuality(rep(c(22L, 12L), times = c(36, 18))), subjectQuality = SolexaQuality(rep(c(22L, 12L), times = c(40, 20))), fuzzyMatrix = mapping, type = "local") ## Amino acid global alignment pairwiseAlignment(AAString("PAWHEAE"), AAString("HEAGAWGHEE"), substitutionMatrix = "BLOSUM50", gapOpening = 0, gapExtension = 8)## Nucleotide global, local, and overlap alignments s1 <- DNAString("ACTTCACCAGCTCCCTGGCGGTAAGTTGATCAAAGGAAACGCAAAGTTTTCAAG") s2 <- DNAString("GTTTCACTACTTCCTTTCGGGTAAGTAAATATATAAATATATAAAAATATAATTTTCATC") # First use a fixed substitution matrix mat <- nucleotideSubstitutionMatrix(match = 1, mismatch = -3, baseOnly = TRUE) globalAlign <- pairwiseAlignment(s1, s2, substitutionMatrix = mat, gapOpening = 5, gapExtension = 2) localAlign <- pairwiseAlignment(s1, s2, type = "local", substitutionMatrix = mat, gapOpening = 5, gapExtension = 2) overlapAlign <- pairwiseAlignment(s1, s2, type = "overlap", substitutionMatrix = mat, gapOpening = 5, gapExtension = 2) # Then use quality-based method for generating a substitution matrix pairwiseAlignment(s1, s2, patternQuality = SolexaQuality(rep(c(22L, 12L), times = c(36, 18))), subjectQuality = SolexaQuality(rep(c(22L, 12L), times = c(40, 20))), scoreOnly = TRUE) # Now assume can't distinguish between C/T and G/A pairwiseAlignment(s1, s2, patternQuality = SolexaQuality(rep(c(22L, 12L), times = c(36, 18))), subjectQuality = SolexaQuality(rep(c(22L, 12L), times = c(40, 20))), type = "local") mapping <- diag(4) dimnames(mapping) <- list(DNA_BASES, DNA_BASES) mapping["C", "T"] <- mapping["T", "C"] <- 1 mapping["G", "A"] <- mapping["A", "G"] <- 1 pairwiseAlignment(s1, s2, patternQuality = SolexaQuality(rep(c(22L, 12L), times = c(36, 18))), subjectQuality = SolexaQuality(rep(c(22L, 12L), times = c(40, 20))), fuzzyMatrix = mapping, type = "local") ## Amino acid global alignment pairwiseAlignment(AAString("PAWHEAE"), AAString("HEAGAWGHEE"), substitutionMatrix = "BLOSUM50", gapOpening = 0, gapExtension = 8)
The PairwiseAlignments class is a container for storing
a set of pairwise alignments.
The PairwiseAlignmentsSingleSubject class is a container for storing
a set of pairwise alignments with a single subject.
The PairwiseAlignmentsSingleSubjectSummary class is a container for storing
the summary of a set of pairwise alignments.
## Constructors: ## When subject is missing, pattern must be of length 2 ## S4 method for signature 'XString,XString' PairwiseAlignments(pattern, subject, type = "global", substitutionMatrix = NULL, gapOpening = 0, gapExtension = 1) ## S4 method for signature 'XStringSet,missing' PairwiseAlignments(pattern, subject, type = "global", substitutionMatrix = NULL, gapOpening = 0, gapExtension = 1) ## S4 method for signature 'character,character' PairwiseAlignments(pattern, subject, type = "global", substitutionMatrix = NULL, gapOpening = 0, gapExtension = 1, baseClass = "BString") ## S4 method for signature 'character,missing' PairwiseAlignments(pattern, subject, type = "global", substitutionMatrix = NULL, gapOpening = 0, gapExtension = 1, baseClass = "BString")## Constructors: ## When subject is missing, pattern must be of length 2 ## S4 method for signature 'XString,XString' PairwiseAlignments(pattern, subject, type = "global", substitutionMatrix = NULL, gapOpening = 0, gapExtension = 1) ## S4 method for signature 'XStringSet,missing' PairwiseAlignments(pattern, subject, type = "global", substitutionMatrix = NULL, gapOpening = 0, gapExtension = 1) ## S4 method for signature 'character,character' PairwiseAlignments(pattern, subject, type = "global", substitutionMatrix = NULL, gapOpening = 0, gapExtension = 1, baseClass = "BString") ## S4 method for signature 'character,missing' PairwiseAlignments(pattern, subject, type = "global", substitutionMatrix = NULL, gapOpening = 0, gapExtension = 1, baseClass = "BString")
pattern |
a character vector of length 1 or 2, an |
subject |
a character vector of length 1 or an |
type |
type of alignment. One of |
substitutionMatrix |
substitution matrix for the alignment. If NULL, the diagonal values and off-diagonal values are set to 0 and 1 respectively. |
gapOpening |
the cost for opening a gap in the alignment. |
gapExtension |
the incremental cost incurred along the length of the gap in the alignment. |
baseClass |
the base |
Before we define the notion of alignment, we introduce the notion of "filled-with-gaps subsequence". A "filled-with-gaps subsequence" of a string string1 is obtained by inserting 0 or any number of gaps in a subsequence of s1. For example L-A–ND and A–N-D are "filled-with-gaps subsequences" of LAND. An alignment between two strings string1 and string2 results in two strings (align1 and align2) that have the same length and are "filled-with-gaps subsequences" of string1 and string2.
For example, this is an alignment between LAND and LEAVES:
L-A
LEA
An alignment can be seen as a compact representation of one set of basic operations that transforms string1 into align1. There are 3 different kinds of basic operations: "insertions" (gaps in align1), "deletions" (gaps in align2), "replacements". The above alignment represents the following basic operations:
insert E at pos 2
insert V at pos 4
insert E at pos 5
replace by S at pos 6 (N is replaced by S)
delete at pos 7 (D is deleted)
Note that "insert X at pos i" means that all letters at a position >= i are moved 1 place to the right before X is actually inserted.
There are many possible alignments between two given strings string1 and string2 and a common problem is to find the one (or those ones) with the highest score, i.e. with the lower total cost in terms of basic operations.
In the code snippets below,
x is a PairwiseAlignments object, except otherwise noted.
alignedPattern(x), alignedSubject(x):Extract the aligned patterns or subjects as an XStringSet object.
The 2 objects returned by alignedPattern(x) and
alignedSubject(x) are guaranteed to have the same
shape (i.e. same length() and width()).
pattern(x), subject(x):Extract the aligned patterns or subjects as an AlignedXStringSet0
object.
summary(object, ...):Generates a summary for the PairwiseAlignments object.
In the code snippets below,
x is a PairwiseAlignments object, except otherwise noted.
alphabet(x):Equivalent to alphabet(unaligned(subject(x))).
length(x):The common length of alignedPattern(x) and
alignedSubject(x).
There is a method for PairwiseAlignmentsSingleSubjectSummary
as well.
type(x):The type of the alignment ("global", "local",
"overlap", "global-local", or "local-global").
There is a method for PairwiseAlignmentsSingleSubjectSummary as well.
In the code snippets below,
x is a PairwiseAlignmentsSingleSubject object, except
otherwise noted.
aligned(x, degap = FALSE, gapCode="-", endgapCode="-"):If degap = FALSE, "align" the alignments by returning an
XStringSet object containing the aligned patterns without
insertions. If degap = TRUE, returns
aligned(pattern(x), degap=TRUE).
The gapCode and endgapCode arguments denote the code in the
appropriate alphabet to use for the internal and end gaps.
as.character(x):Equivalent to as.character(alignedPattern(x)).
as.matrix(x):Returns an "exploded" character matrix representation of aligned(x).
toString(x):Equivalent to toString(as.character(x)).
In the code snippets below,
x is a PairwiseAlignmentsSingleSubject object, except otherwise noted.
consensusMatrix(x, as.prob=FALSE, baseOnly=FALSE, gapCode="-",
endgapCode="-"):See 'consensusMatrix' for more information.
consensusString(x):See 'consensusString' for more information.
coverage(x, shift=0L, width=NULL, weight=1L):See 'coverage,PairwiseAlignmentsSingleSubject-method' for more information.
Views(subject, start=NULL, end=NULL, width=NULL, names=NULL):The XStringViews object that represents the pairwise alignments
along unaligned(subject(subject)). The start and end
arguments must be either NULL/NA or an integer vector
of length 1 that denotes the offset from start(subject(subject)).
In the code snippets below,
x is a PairwiseAlignments object, except otherwise noted.
nchar(x):The nchar of the aligned(pattern(x)) and aligned(subject(x)).
There is a method for PairwiseAlignmentsSingleSubjectSummary as well.
insertion(x):An CompressedIRangesList
object containing the locations of the insertions from the perspective
of the pattern.
deletion(x):An CompressedIRangesList
object containing the locations of the deletions from the perspective
of the pattern.
indel(x):An InDel object containing the locations of the insertions and
deletions from the perspective of the pattern.
nindel(x):An InDel object containing the number of insertions and deletions.
score(x):The score of the alignment.
There is a method for PairwiseAlignmentsSingleSubjectSummary
as well.
x[i]:Returns a new PairwiseAlignments object made of the selected
elements.
rep(x, times):Returns a new PairwiseAlignments object made of the repeated
elements.
P. Aboyoun
pairwiseAlignment,
writePairwiseAlignments,
AlignedXStringSet-class,
XString-class,
XStringViews-class,
align-utils,
pid
PairwiseAlignments("-PA--W-HEAE", "HEAGAWGHE-E") pattern <- AAStringSet(c("HLDNLKGTF", "HVDDMPNAKLLL")) subject <- AAString("SHLDTEKMSMKLL") pa1 <- pairwiseAlignment(pattern, subject, substitutionMatrix="BLOSUM50", gapOpening=3, gapExtension=1) pa1 alignedPattern(pa1) alignedSubject(pa1) stopifnot(identical(width(alignedPattern(pa1)), width(alignedSubject(pa1)))) as.character(pa1) aligned(pa1) as.matrix(pa1) nchar(pa1) score(pa1)PairwiseAlignments("-PA--W-HEAE", "HEAGAWGHE-E") pattern <- AAStringSet(c("HLDNLKGTF", "HVDDMPNAKLLL")) subject <- AAString("SHLDTEKMSMKLL") pa1 <- pairwiseAlignment(pattern, subject, substitutionMatrix="BLOSUM50", gapOpening=3, gapExtension=1) pa1 alignedPattern(pa1) alignedSubject(pa1) stopifnot(identical(width(alignedPattern(pa1)), width(alignedSubject(pa1)))) as.character(pa1) aligned(pa1) as.matrix(pa1) nchar(pa1) score(pa1)
The writePairwiseAlignments function writes a
PairwiseAlignments object to a file.
Only the "pair" format is supported at the moment.
writePairwiseAlignments(x, file="", Matrix=NA, block.width=50)writePairwiseAlignments(x, file="", Matrix=NA, block.width=50)
x |
A PairwiseAlignments object, typically returned by the
|
file |
A connection, or a character string naming the file to print
to. If |
Matrix |
A single string containing the name of the substitution matrix
(e.g. |
block.width |
A single integer specifying the maximum number of sequence letters (including the "-" letter, which represents gaps) per line. |
The "pair" format is one of the numerous pairwise sequence alignment formats supported by the EMBOSS software. See http://emboss.sourceforge.net/docs/themes/AlignFormats.html for a brief (and rather informal) description of this format.
Nothing (invisible NULL).
This brief description of the "pair" format suggests that it is best suited for global pairwise alignments, because, in that case, the original pattern and subject sequences can be inferred (by just removing the gaps).
However, even though the "pair" format can also be used for non global
pairwise alignments (i.e. for global-local, local-global,
and local pairwise alignments), in that case the original
pattern and subject sequences cannot be inferred. This is because
the alignment written to the file doesn't necessarily span the entire
pattern (if type(x) is local-global or local)
or the entire subject (if type(x) is global-local
or local).
As a consequence, the writePairwiseAlignments function can be
used on a PairwiseAlignments object x containing non global
alignments (i.e. with type(x) != "global"), but with the 2 following
caveats:
The type of the alignments (type(x)) is not written
to the file.
The original pattern and subject sequences cannot be inferred. Furthermore, there is no way to infer their lengths (because we don't know whether they were trimmed or not).
Also note that the pairwiseAlignment function
interprets the gapOpening and gapExtension arguments
differently than most other alignment tools. As a consequence
the values of the Gap_penalty and Extend_penalty fields written to
the file are not the same as the values that were passed to the
gapOpening and gapExtension arguments. With the
following relationship:
Gap_penalty = gapOpening + gapExtension
Extend_penalty = gapExtension
H. Pagès
http://emboss.sourceforge.net/docs/themes/AlignFormats.html
## --------------------------------------------------------------------- ## A. WITH ONE PAIR ## --------------------------------------------------------------------- pattern <- DNAString("CGTACGTAACGTTCGT") subject <- DNAString("CGTCGTCGTCCGTAA") pa1 <- pairwiseAlignment(pattern, subject) pa1 writePairwiseAlignments(pa1) writePairwiseAlignments(pa1, block.width=10) ## The 2 bottom-right numbers (16 and 15) are the lengths of ## the original pattern and subject, respectively. pa2 <- pairwiseAlignment(pattern, subject, type="global-local") pa2 # score is different! writePairwiseAlignments(pa2) ## By just looking at the file, we can't tell the length of the ## original subject! Could be 13, could be more... pattern <- DNAString("TCAACTTAACTT") subject <- DNAString("GGGCAACAACGGG") pa3 <- pairwiseAlignment(pattern, subject, type="global-local", gapOpening=-2, gapExtension=-1) writePairwiseAlignments(pa3) ## --------------------------------------------------------------------- ## B. WITH MORE THAN ONE PAIR (AND NAMED PATTERNS) ## --------------------------------------------------------------------- pattern <- DNAStringSet(c(myp1="ACCA", myp2="ACGCA", myp3="ACGGCA")) pa4 <- pairwiseAlignment(pattern, subject) pa4 writePairwiseAlignments(pa4) ## --------------------------------------------------------------------- ## C. REPRODUCING THE ALIGNMENT SHOWN AT ## http://emboss.sourceforge.net/docs/themes/alnformats/align.pair ## --------------------------------------------------------------------- pattern <- c("TSPASIRPPAGPSSRPAMVSSRRTRPSPPGPRRPTGRPCCSAAPRRPQAT", "GGWKTCSGTCTTSTSTRHRGRSGWSARTTTAACLRASRKSMRAACSRSAG", "SRPNRFAPTLMSSCITSTTGPPAWAGDRSHE") subject <- c("TSPASIRPPAGPSSRRPSPPGPRRPTGRPCCSAAPRRPQATGGWKTCSGT", "CTTSTSTRHRGRSGWRASRKSMRAACSRSAGSRPNRFAPTLMSSCITSTT", "GPPAWAGDRSHE") pattern <- unlist(AAStringSet(pattern)) subject <- unlist(AAStringSet(subject)) pattern # original pattern subject # original subject data(BLOSUM62) pa5 <- pairwiseAlignment(pattern, subject, substitutionMatrix=BLOSUM62, gapOpening=9.5, gapExtension=0.5) pa5 writePairwiseAlignments(pa5, Matrix="BLOSUM62")## --------------------------------------------------------------------- ## A. WITH ONE PAIR ## --------------------------------------------------------------------- pattern <- DNAString("CGTACGTAACGTTCGT") subject <- DNAString("CGTCGTCGTCCGTAA") pa1 <- pairwiseAlignment(pattern, subject) pa1 writePairwiseAlignments(pa1) writePairwiseAlignments(pa1, block.width=10) ## The 2 bottom-right numbers (16 and 15) are the lengths of ## the original pattern and subject, respectively. pa2 <- pairwiseAlignment(pattern, subject, type="global-local") pa2 # score is different! writePairwiseAlignments(pa2) ## By just looking at the file, we can't tell the length of the ## original subject! Could be 13, could be more... pattern <- DNAString("TCAACTTAACTT") subject <- DNAString("GGGCAACAACGGG") pa3 <- pairwiseAlignment(pattern, subject, type="global-local", gapOpening=-2, gapExtension=-1) writePairwiseAlignments(pa3) ## --------------------------------------------------------------------- ## B. WITH MORE THAN ONE PAIR (AND NAMED PATTERNS) ## --------------------------------------------------------------------- pattern <- DNAStringSet(c(myp1="ACCA", myp2="ACGCA", myp3="ACGGCA")) pa4 <- pairwiseAlignment(pattern, subject) pa4 writePairwiseAlignments(pa4) ## --------------------------------------------------------------------- ## C. REPRODUCING THE ALIGNMENT SHOWN AT ## http://emboss.sourceforge.net/docs/themes/alnformats/align.pair ## --------------------------------------------------------------------- pattern <- c("TSPASIRPPAGPSSRPAMVSSRRTRPSPPGPRRPTGRPCCSAAPRRPQAT", "GGWKTCSGTCTTSTSTRHRGRSGWSARTTTAACLRASRKSMRAACSRSAG", "SRPNRFAPTLMSSCITSTTGPPAWAGDRSHE") subject <- c("TSPASIRPPAGPSSRRPSPPGPRRPTGRPCCSAAPRRPQATGGWKTCSGT", "CTTSTSTRHRGRSGWRASRKSMRAACSRSAGSRPNRFAPTLMSSCITSTT", "GPPAWAGDRSHE") pattern <- unlist(AAStringSet(pattern)) subject <- unlist(AAStringSet(subject)) pattern # original pattern subject # original subject data(BLOSUM62) pa5 <- pairwiseAlignment(pattern, subject, substitutionMatrix=BLOSUM62, gapOpening=9.5, gapExtension=0.5) pa5 writePairwiseAlignments(pa5, Matrix="BLOSUM62")
Six versions of the complete genome for bacteriophage X174 as
well as a small number of Solexa short reads, qualities associated with
those short reads, and counts for the number times those short reads occurred.
phiX174Phage: A DNAStringSet containing the following six
naturally occurring versions of the bacteriophage X174 genome
cited in Smith et al.:
Genbank: The version of the genome from GenBank (NC_001422.1, GI:9626372).
RF70s: A preparation of X double-stranded replicative
form (RF) of DNA by Clyde A. Hutchison III from the late 1970s.
SS78: A preparation of X virion single-stranded DNA
from 1978.
Bull: The sequence of wild-type X used by Bull et al.
G'97: The X replicative form (RF) of DNA from Bull et al.
NEB'03: A X replicative form (RF) of DNA from New
England BioLabs (NEB).
srPhiX174: A DNAStringSet containing short reads from a
Solexa machine.
quPhiX174: A BStringSet containing Solexa quality scores
associated with srPhiX174.
wtPhiX174: An integer vector containing counts associated with
srPhiX174.
P. Aboyoun
Bull, J. J., Badgett, M. R., Wichman, H. A., Huelsenbeck, Hillis, D. M., Gulati, A., Ho, C. & Molineux, J. (1997) Genetics 147, 1497-1507.
Smith, Hamilton O.; Clyde A. Hutchison, Cynthia Pfannkoch, J. Craig Venter (2003-12-23). "Generating a synthetic genome by whole genome assembly: {phi}X174 bacteriophage from synthetic oligonucleotides". Proceedings of the National Academy of Sciences 100 (26): 15440-15445. doi:10.1073/pnas.2237126100.
data(phiX174Phage) nchar(phiX174Phage) genBankPhage <- phiX174Phage[[1]] genBankSubstring <- substring(genBankPhage, 2793-34, 2811+34) data(srPhiX174) srPhiX174 quPhiX174 summary(wtPhiX174) alignPhiX174 <- pairwiseAlignment(srPhiX174, genBankSubstring, patternQuality=SolexaQuality(quPhiX174), subjectQuality=SolexaQuality(99L), type="global-local") summary(alignPhiX174, weight=wtPhiX174)data(phiX174Phage) nchar(phiX174Phage) genBankPhage <- phiX174Phage[[1]] genBankSubstring <- substring(genBankPhage, 2793-34, 2811+34) data(srPhiX174) srPhiX174 quPhiX174 summary(wtPhiX174) alignPhiX174 <- pairwiseAlignment(srPhiX174, genBankSubstring, patternQuality=SolexaQuality(quPhiX174), subjectQuality=SolexaQuality(99L), type="global-local") summary(alignPhiX174, weight=wtPhiX174)
Calculates the percent sequence identity for a pairwise sequence alignment.
pid(x, type="PID1")pid(x, type="PID1")
x |
a |
type |
one of percent sequence identity. One of |
Since there is no universal definition of percent sequence identity, the pid function
calculates this statistic in the following types:
"PID1":100 * (identical positions) / (aligned positions + internal gap positions)
"PID2":100 * (identical positions) / (aligned positions)
"PID3":100 * (identical positions) / (length shorter sequence)
"PID4":100 * (identical positions) / (average length of the two sequences)
A numeric vector containing the specified sequence identity measures.
P. Aboyoun
A. May, Percent Sequence Identity: The Need to Be Explicit, Structure 2004, 12(5):737.
G. Raghava and G. Barton, Quantification of the variation in percentage identity for protein sequence alignments, BMC Bioinformatics 2006, 7:415.
pairwiseAlignment, PairwiseAlignments-class, match-utils
s1 <- DNAString("AGTATAGATGATAGAT") s2 <- DNAString("AGTAGATAGATGGATGATAGATA") palign1 <- pairwiseAlignment(s1, s2) palign1 pid(palign1) palign2 <- pairwiseAlignment(s1, s2, substitutionMatrix = nucleotideSubstitutionMatrix(match = 2, mismatch = 10, baseOnly = TRUE)) palign2 pid(palign2, type = "PID4")s1 <- DNAString("AGTATAGATGATAGAT") s2 <- DNAString("AGTAGATAGATGGATGATAGATA") palign1 <- pairwiseAlignment(s1, s2) palign1 pid(palign1) palign2 <- pairwiseAlignment(s1, s2, substitutionMatrix = nucleotideSubstitutionMatrix(match = 2, mismatch = 10, baseOnly = TRUE)) palign2 pid(palign2, type = "PID4")
Predefined scoring matrices for nucleotide and amino acid alignments.
data(BLOSUM45) data(BLOSUM50) data(BLOSUM62) data(BLOSUM80) data(BLOSUM100) data(PAM30) data(PAM40) data(PAM70) data(PAM120) data(PAM250)data(BLOSUM45) data(BLOSUM50) data(BLOSUM62) data(BLOSUM80) data(BLOSUM100) data(PAM30) data(PAM40) data(PAM70) data(PAM120) data(PAM250)
The BLOSUM and PAM matrices are square symmetric matrices with integer coefficients, whose row and column names are identical and unique: each name is a single letter representing a nucleotide or an amino acid.
The BLOSUM and PAM matrices are not unique. For example, the definition of the widely used BLOSUM62 matrix varies depending on the source, and even a given source can provide different versions of "BLOSUM62" without keeping track of the changes over time. NCBI provides many matrices here ftp://ftp.ncbi.nih.gov/blast/matrices/ but their definitions don't match those of the matrices bundled with their stand-alone BLAST software available here ftp://ftp.ncbi.nih.gov/blast/
The BLOSUM45, BLOSUM62, BLOSUM80, PAM30 and PAM70 matrices were taken from NCBI stand-alone BLAST software.
The BLOSUM50, BLOSUM100, PAM40, PAM120 and PAM250 matrices were taken from ftp://ftp.ncbi.nih.gov/blast/matrices/
H. Pagès and P. Aboyoun
nucleotideSubstitutionMatrix,
pairwiseAlignment,
PairwiseAlignments-class,
DNAString-class,
AAString-class,
PhredQuality-class,
SolexaQuality-class,
IlluminaQuality-class
## Align two amino acid sequences with the BLOSUM62 matrix: aa1 <- AAString("HXBLVYMGCHFDCXVBEHIKQZ") aa2 <- AAString("QRNYMYCFQCISGNEYKQN") pairwiseAlignment(aa1, aa2, substitutionMatrix="BLOSUM62", gapOpening=3, gapExtension=1) ## See how the gap penalty influences the alignment: pairwiseAlignment(aa1, aa2, substitutionMatrix="BLOSUM62", gapOpening=6, gapExtension=2) ## See how the substitution matrix influences the alignment: pairwiseAlignment(aa1, aa2, substitutionMatrix="BLOSUM50", gapOpening=3, gapExtension=1) if (interactive()) { ## Compare our BLOSUM62 with BLOSUM62 from ## ftp://ftp.ncbi.nih.gov/blast/matrices/: data(BLOSUM62) BLOSUM62["Q", "Z"] file <- "ftp://ftp.ncbi.nih.gov/blast/matrices/BLOSUM62" b62 <- as.matrix(read.table(file, check.names=FALSE)) b62["Q", "Z"] }## Align two amino acid sequences with the BLOSUM62 matrix: aa1 <- AAString("HXBLVYMGCHFDCXVBEHIKQZ") aa2 <- AAString("QRNYMYCFQCISGNEYKQN") pairwiseAlignment(aa1, aa2, substitutionMatrix="BLOSUM62", gapOpening=3, gapExtension=1) ## See how the gap penalty influences the alignment: pairwiseAlignment(aa1, aa2, substitutionMatrix="BLOSUM62", gapOpening=6, gapExtension=2) ## See how the substitution matrix influences the alignment: pairwiseAlignment(aa1, aa2, substitutionMatrix="BLOSUM50", gapOpening=3, gapExtension=1) if (interactive()) { ## Compare our BLOSUM62 with BLOSUM62 from ## ftp://ftp.ncbi.nih.gov/blast/matrices/: data(BLOSUM62) BLOSUM62["Q", "Z"] file <- "ftp://ftp.ncbi.nih.gov/blast/matrices/BLOSUM62" b62 <- as.matrix(read.table(file, check.names=FALSE)) b62["Q", "Z"] }
Computes the Levenshtein edit distance or pairwise alignment score matrix for a set of strings.
stringDist(x, method = "levenshtein", ignoreCase = FALSE, diag = FALSE, upper = FALSE, ...) ## S4 method for signature 'XStringSet' stringDist(x, method = "levenshtein", ignoreCase = FALSE, diag = FALSE, upper = FALSE, type = "global", quality = PhredQuality(22L), substitutionMatrix = NULL, fuzzyMatrix = NULL, gapOpening = 0, gapExtension = 1) ## S4 method for signature 'QualityScaledXStringSet' stringDist(x, method = "quality", ignoreCase = FALSE, diag = FALSE, upper = FALSE, type = "global", substitutionMatrix = NULL, fuzzyMatrix = NULL, gapOpening = 0, gapExtension = 1)stringDist(x, method = "levenshtein", ignoreCase = FALSE, diag = FALSE, upper = FALSE, ...) ## S4 method for signature 'XStringSet' stringDist(x, method = "levenshtein", ignoreCase = FALSE, diag = FALSE, upper = FALSE, type = "global", quality = PhredQuality(22L), substitutionMatrix = NULL, fuzzyMatrix = NULL, gapOpening = 0, gapExtension = 1) ## S4 method for signature 'QualityScaledXStringSet' stringDist(x, method = "quality", ignoreCase = FALSE, diag = FALSE, upper = FALSE, type = "global", substitutionMatrix = NULL, fuzzyMatrix = NULL, gapOpening = 0, gapExtension = 1)
x |
a character vector or an |
method |
calculation method. One of |
ignoreCase |
logical value indicating whether to ignore case during scoring. |
diag |
logical value indicating whether the diagonal of the matrix
should be printed by |
upper |
logical value indicating whether the upper triangle of the matrix
should be printed by |
type |
(applicable when |
quality |
(applicable when |
substitutionMatrix |
(applicable when
|
fuzzyMatrix |
(applicable when |
gapOpening |
(applicable when |
gapExtension |
(applicable when |
... |
optional arguments to generic function to support additional methods. |
When method = "hamming", uses the underlying neditStartingAt code
to calculate the distances, where the Hamming distance is defined as the number
of substitutions between two strings of equal length. Otherwise, uses the
underlying pairwiseAlignment code to compute the distance/alignment
score matrix.
Returns an object of class "dist".
P. Aboyoun
dist, agrep, pairwiseAlignment, substitution_matrices
stringDist(c("lazy", "HaZy", "crAzY")) stringDist(c("lazy", "HaZy", "crAzY"), ignoreCase = TRUE) data(phiX174Phage) plot(hclust(stringDist(phiX174Phage), method = "single")) data(srPhiX174) stringDist(srPhiX174[1:4]) stringDist(srPhiX174[1:4], method = "quality", quality = SolexaQuality(quPhiX174[1:4]), gapOpening = 10, gapExtension = 4)stringDist(c("lazy", "HaZy", "crAzY")) stringDist(c("lazy", "HaZy", "crAzY"), ignoreCase = TRUE) data(phiX174Phage) plot(hclust(stringDist(phiX174Phage), method = "single")) data(srPhiX174) stringDist(srPhiX174[1:4]) stringDist(srPhiX174[1:4], method = "quality", quality = SolexaQuality(quPhiX174[1:4]), gapOpening = 10, gapExtension = 4)
Utilities to generate substitution matrices.
nucleotideSubstitutionMatrix(match=1, mismatch=0, baseOnly=FALSE, type="DNA", symmetric=TRUE) qualitySubstitutionMatrices(fuzzyMatch=c(0, 1), alphabetLength=4L, qualityClass="PhredQuality", bitScale=1) errorSubstitutionMatrices(errorProbability, fuzzyMatch=c(0, 1), alphabetLength=4L, bitScale=1)nucleotideSubstitutionMatrix(match=1, mismatch=0, baseOnly=FALSE, type="DNA", symmetric=TRUE) qualitySubstitutionMatrices(fuzzyMatch=c(0, 1), alphabetLength=4L, qualityClass="PhredQuality", bitScale=1) errorSubstitutionMatrices(errorProbability, fuzzyMatch=c(0, 1), alphabetLength=4L, bitScale=1)
match |
the scoring for a nucleotide match. |
mismatch |
the scoring for a nucleotide mismatch. |
baseOnly |
|
type |
either "DNA" or "RNA". |
symmetric |
|
fuzzyMatch |
a named or unnamed numeric vector representing the base match probability. |
errorProbability |
a named or unnamed numeric vector representing the error probability. |
alphabetLength |
an integer representing the number of letters in the underlying string alphabet. For DNA and RNA, this would be 4L. For Amino Acids, this could be 20L. |
qualityClass |
a character string of |
bitScale |
a numeric value to scale the quality-based substitution matrices. By default, this is 1, representing bit-scale scoring. |
The quality matrices computed in qualitySubstitutionMatrices are
based on the paper by Ketil Malde. Let be the probability
of an error in the base read. For "Phred" quality measures
in , these error probabilities are given by
. For "Solexa" quality measures
in , they are given by
.
Assuming independence within and between base reads, the combined error
probability of a mismatch when the underlying bases do match is
,
where is the number of letters in the underlying alphabet. Using
, the substitution score is given by when two bases match is given by
,
where is the bit-scaling for the scoring and is the
probability that characters and represents the same underlying
information (e.g. using IUPAC, and .
In the arguments listed above fuzzyMatch represents
and errorProbability represents .
A matrix.
P. Aboyoun, with contribution from Albert Vill (support for
asymmetric matrices in nucleotideSubstitutionMatrix())
K. Malde, The effect of sequence quality on sequence alignment, Bioinformatics, Feb 23, 2008.
predefined_scoring_matrices,
pairwiseAlignment,
PairwiseAlignments-class,
DNAString-class,
AAString-class,
PhredQuality-class,
SolexaQuality-class,
IlluminaQuality-class
s1 <- DNAString("ACTTCACCAGCTCCCTGGCGGTAAGTTGATCAAAGGAAACGCAAAGTTTTCAAG") s2 <- DNAString("GTTTCACTACTTCCTTTCGGGTAAGTAAATATATAAATATATAAAAATATAATTTTCATC") s3 <- DNAString("NCTTCRCCAGCTCCCTGGMGGTAAGTTGATCAAAGVAAACGCAAAGTTNTCAAG") ## Fit a global pairwise alignment using edit distance scoring: nsm <- nucleotideSubstitutionMatrix(0, -1, TRUE) pairwiseAlignment(s1, s2, substitutionMatrix=nsm, gapOpening=0, gapExtension=1) ## Align sequences using an asymmetric substitution matrix. ## The asymmetry of the matrix means that the query sequence is not ## penalized for ambiguous bases in the subject / consensus sequence: ansm <- nucleotideSubstitutionMatrix(symmetric=FALSE) ansm["M", c("A","C","G","T")] # A C G T # 0.5 0.5 0.0 0.0 ansm[c("A","C","G","T"), "M"] # A C G T # 1 1 0 0 ansm["M", "H"] # 1 ansm["H", "M"] # 0.6666667 ## Due to this asymmetry, the order of the sequences is important: pairwiseAlignment(s1, s3, substitutionMatrix=ansm) pairwiseAlignment(s3, s1, substitutionMatrix=ansm) ## Examine quality-based match and mismatch bit scores for DNA/RNA ## strings in pairwiseAlignment. By default patternQuality and ## subjectQuality are PhredQuality(22L): qualityMatrices <- qualitySubstitutionMatrices() qualityMatrices["22", "22", "1"] qualityMatrices["22", "22", "0"] pairwiseAlignment(s1, s2) ## Get the substitution scores when the error probability is 0.1: subscores <- errorSubstitutionMatrices(errorProbability=0.1) submat <- matrix(subscores[ , , "0"], 4, 4) diag(submat) <- subscores[ , , "1"] dimnames(submat) <- list(DNA_ALPHABET[1:4], DNA_ALPHABET[1:4]) submat pairwiseAlignment(s1, s2, substitutionMatrix=submat)s1 <- DNAString("ACTTCACCAGCTCCCTGGCGGTAAGTTGATCAAAGGAAACGCAAAGTTTTCAAG") s2 <- DNAString("GTTTCACTACTTCCTTTCGGGTAAGTAAATATATAAATATATAAAAATATAATTTTCATC") s3 <- DNAString("NCTTCRCCAGCTCCCTGGMGGTAAGTTGATCAAAGVAAACGCAAAGTTNTCAAG") ## Fit a global pairwise alignment using edit distance scoring: nsm <- nucleotideSubstitutionMatrix(0, -1, TRUE) pairwiseAlignment(s1, s2, substitutionMatrix=nsm, gapOpening=0, gapExtension=1) ## Align sequences using an asymmetric substitution matrix. ## The asymmetry of the matrix means that the query sequence is not ## penalized for ambiguous bases in the subject / consensus sequence: ansm <- nucleotideSubstitutionMatrix(symmetric=FALSE) ansm["M", c("A","C","G","T")] # A C G T # 0.5 0.5 0.0 0.0 ansm[c("A","C","G","T"), "M"] # A C G T # 1 1 0 0 ansm["M", "H"] # 1 ansm["H", "M"] # 0.6666667 ## Due to this asymmetry, the order of the sequences is important: pairwiseAlignment(s1, s3, substitutionMatrix=ansm) pairwiseAlignment(s3, s1, substitutionMatrix=ansm) ## Examine quality-based match and mismatch bit scores for DNA/RNA ## strings in pairwiseAlignment. By default patternQuality and ## subjectQuality are PhredQuality(22L): qualityMatrices <- qualitySubstitutionMatrices() qualityMatrices["22", "22", "1"] qualityMatrices["22", "22", "0"] pairwiseAlignment(s1, s2) ## Get the substitution scores when the error probability is 0.1: subscores <- errorSubstitutionMatrices(errorProbability=0.1) submat <- matrix(subscores[ , , "0"], 4, 4) diag(submat) <- subscores[ , , "1"] dimnames(submat) <- list(DNA_ALPHABET[1:4], DNA_ALPHABET[1:4]) submat pairwiseAlignment(s1, s2, substitutionMatrix=submat)