| Title: | specL - Prepare Peptide Spectrum Matches for Use in Targeted Proteomics |
|---|---|
| Description: | provides a functions for generating spectra libraries that can be used for MRM SRM MS workflows in proteomics. The package provides a BiblioSpec reader, a function which can add the protein information using a FASTA formatted amino acid file, and an export method for using the created library in the Spectronaut software. The package is developed, tested and used at the Functional Genomics Center Zurich <https://fgcz.ch>. |
| Authors: | Christian Panse [aut, cre] (ORCID: <https://orcid.org/0000-0003-1975-3064>), Jonas Grossmann [aut] (ORCID: <https://orcid.org/0000-0002-6899-9020>), Christian Trachsel [aut], Witold E. Wolski [ctb] |
| Maintainer: | Christian Panse <[email protected]> |
| License: | GPL-3 |
| Version: | 1.46.0 |
| Built: | 2026-05-30 10:56:59 UTC |
| Source: | https://github.com/bioc/specL |
This function assigns the protein identifier for a list of tandem mass specs having a peptide sequence assigned.
annotate.protein_id(data, file = NULL, fasta = read.fasta(file = file, as.string = TRUE, seqtype = "AA"), digestPattern = "(([RK])|(^)|(^M))")annotate.protein_id(data, file = NULL, fasta = read.fasta(file = file, as.string = TRUE, seqtype = "AA"), digestPattern = "(([RK])|(^)|(^M))")
data |
list of records containing mZ and peptide sequences. |
file |
file name of a FASTA file. |
fasta |
a fasta object as returned by the |
digestPattern |
a regex pattern which can be used by the |
The protein sequences a read by the read.fasta function
of the seqinr package. The protein identifier is written
to the protein proteinInformation variable.
If the function is called on a multi-core architecture it uses mclapply.
It is recommended to load the FASTA file prior to running
annotate.protein_id using
myFASTA <- read.fasta(file = file,
as.string = TRUE,
seqtype = "AA")
instead of providing the FASTA file name to the function.
it returns a list object.
Jonas Grossmann and Christian Panse, 2014
?read.fasta of the seqinr package.
http://www.uniprot.org/help/fasta-headers
# annotate.protein_id # our Fasta sequence irtFASTAseq <- paste(">zz|ZZ_FGCZCont0260|", "iRT_Protein_with_AAAAK_spacers concatenated Biognosys\n", "LGGNEQVTRAAAAKGAGSSEPVTGLDAKAAAAKVEATFGVDESNAKAAAAKYILAGVENS", "KAAAAKTPVISGGPYEYRAAAAKTPVITGAPYEYRAAAAKDGLDAASYYAPVRAAAAKAD", "VTPADFSEWSKAAAAKGTFIIDPGGVIRAAAAKGTFIIDPAAVIRAAAAKLFLQFGAQGS", "PFLK\n") # be realistic, do it from file Tfile <- file(); cat(irtFASTAseq, file = Tfile); #use read.fasta from seqinr fasta.irtFASTAseq <-read.fasta(Tfile, as.string=TRUE, seqtype="AA") close(Tfile) #annotate with proteinID # -> here we find all psms from the one proteinID above peptideStd <- specL::annotate.protein_id(peptideStd, fasta=fasta.irtFASTAseq) #show indices for all PSMs where we have a proteinInformation which(unlist(lapply(peptideStd, function(x){nchar(x$proteinInformation)>0})))# annotate.protein_id # our Fasta sequence irtFASTAseq <- paste(">zz|ZZ_FGCZCont0260|", "iRT_Protein_with_AAAAK_spacers concatenated Biognosys\n", "LGGNEQVTRAAAAKGAGSSEPVTGLDAKAAAAKVEATFGVDESNAKAAAAKYILAGVENS", "KAAAAKTPVISGGPYEYRAAAAKTPVITGAPYEYRAAAAKDGLDAASYYAPVRAAAAKAD", "VTPADFSEWSKAAAAKGTFIIDPGGVIRAAAAKGTFIIDPAAVIRAAAAKLFLQFGAQGS", "PFLK\n") # be realistic, do it from file Tfile <- file(); cat(irtFASTAseq, file = Tfile); #use read.fasta from seqinr fasta.irtFASTAseq <-read.fasta(Tfile, as.string=TRUE, seqtype="AA") close(Tfile) #annotate with proteinID # -> here we find all psms from the one proteinID above peptideStd <- specL::annotate.protein_id(peptideStd, fasta=fasta.irtFASTAseq) #show indices for all PSMs where we have a proteinInformation which(unlist(lapply(peptideStd, function(x){nchar(x$proteinInformation)>0})))
This function computes dynamic SWATH windows (cdsw) for a given
vector of numeric values, an psmSet class, or an specLSet class.
The input R data object can be generated using the
read.bibliospec function.
cdsw(x, n=20, overlap=1, ...)cdsw(x, n=20, overlap=1, ...)
x |
Numeric vector or psmSet class. |
n |
Number of desired SWATH windows. Default is set to 20. |
overlap |
Overlap of SWATH windows. The default is 1 Dalton. |
... |
pass arguments to |
The function determines the SWATH windows using the quantile function.
The output is data.frame having the attributes
from, to, mid, width, and counts.
In the ideal output all bins should contain the same number of numeric values.
This requirement is violated because the window borders are rounded with no
digit after the comma.
Christian Panse, Christian Trachsel, 2015, 2016
The S3 class definition:
showClass("psmSet")
# do not plot histogram cdsw(peptideStd, plot = FALSE, overlap = 0) # plot hist cdsw(peptideStd, freq = TRUE) # pre-filtering ## cdsw(x=q1[350 <= q1 & q1 <= 1250], n=20, overlap = 0, freq=TRUE)# do not plot histogram cdsw(peptideStd, plot = FALSE, overlap = 0) # plot hist cdsw(peptideStd, freq = TRUE) # pre-filtering ## cdsw(x=q1[350 <= q1 & q1 <= 1250], n=20, overlap = 0, freq=TRUE)
This function generates an ion library for SWATH analysis.
It takes a R data object which contains a peak list.
The R data object can be generated using the
read.bibliospec function.
genSwathIonLib(data, data.fit = data, mascotIonScoreCutOFF=20, proteinIDPattern='', max.mZ.Da.error = 0.1, ignoreMascotIonScore = TRUE, topN = 10, fragmentIonMzRange = c(300, 1800), fragmentIonRange = c(4, 100), fragmentIonFUN = .defaultSwathFragmentIon, iRT = specL::iRTpeptides, AminoAcids = protViz::AA, breaks=NULL, NORMALIZE=.normalize_rt)genSwathIonLib(data, data.fit = data, mascotIonScoreCutOFF=20, proteinIDPattern='', max.mZ.Da.error = 0.1, ignoreMascotIonScore = TRUE, topN = 10, fragmentIonMzRange = c(300, 1800), fragmentIonRange = c(4, 100), fragmentIonFUN = .defaultSwathFragmentIon, iRT = specL::iRTpeptides, AminoAcids = protViz::AA, breaks=NULL, NORMALIZE=.normalize_rt)
data |
data set containing mZ and peptide sequence. |
mascotIonScoreCutOFF |
a value for filtering the specs. |
proteinIDPattern |
a filter for protein. |
max.mZ.Da.error |
the mZ error in Dalton on ms2 level. |
ignoreMascotIonScore |
Boolean if mascot score is considered or not. |
topN |
returns the most |
fragmentIonMzRange |
mZ range filter of fragment ion. |
fragmentIonRange |
range filter of the number of identified fragment ion
which are assigned in the spectrum library set in |
fragmentIonFUN |
|
iRT |
optional table which contains iRT peptides. If an iRT table
is provided (default) a |
AminoAcids |
a list containing of 1-letter code and mono-isotopic mass of
the amino acids. Default uses the |
data.fit |
data set containing mZ and peptide sequence
which is used for normalizing rt using a linear model
|
breaks |
provides a vector of SWATH windows. If q1 (precursor mass) and q3 (fragment ion) fall into the same SWATH window the fragment ion is ignored in the resulting ion library. The follwing code shows an example |
NORMALIZE |
is a |
The function is the main contribution of the specL package.
It generates the spectra library used in a SWATH analysis workflow
out of a mass spectrometric measurement.
genSwathIonLib uses the core functions protViz::findNN,
protViz::fragmentIon, and protViz::aa2mass.
The input is read by using read.bibliospec function of this package
and passed by the data function parameter.
If no BiblioSpec files are available also Mascot DAT files
can be read using scripts contained in the protViz package exec folder.
If the protein information is lost you can benefit
for the specL::annotate.protein_id.Rd method.
The function first appear in the protViz 0.1.45 package.
It has been removed in protViz 0.2.6 to avoid package dependencies.
The output is a data structure defined as specLSet object.
The generic method ionlibrary returns a list of specL objects,
specLSet also stores the input and normalized retention times.
Christian Panse, Christian Trachsel, and Jonas Grossmann 2012, 2013, 2014, 2016
The S4 class definition:
showClass("specL")
showClass("specLSet")
and the package vignette file.
vignette('specL')
myFragmentIon <- function (b, y) { Hydrogen <- 1.007825 Oxygen <- 15.994915 Nitrogen <- 14.003074 b1_ <- (b ) y1_ <- (y ) b2_ <- (b + Hydrogen) / 2 y2_ <- (y + Hydrogen) / 2 b3_ <- (b + 2 * Hydrogen) / 3 y3_ <- (y + 2 * Hydrogen) / 3 return( cbind(b1_, y1_, b2_, y2_, b3_, y3_) ) } peptideStd.ionLib <- genSwathIonLib(data=peptideStd, data.fit=peptideStd.redundant, fragmentIonFUN=myFragmentIon) summary(peptideStd.ionLib) idx<-40 op <- par(mfrow = c(2,1)) plot(peptideStd.ionLib) text(rt.input(peptideStd.ionLib)[idx], rt.normalized(peptideStd.ionLib)[idx], "X", cex=1.5) plot(ionlibrary(peptideStd.ionLib)[[idx]]) ## Not run: write.spectronaut(peptideStd.ionLib, file="peptideStd.ionLib.csv") ## End(Not run)myFragmentIon <- function (b, y) { Hydrogen <- 1.007825 Oxygen <- 15.994915 Nitrogen <- 14.003074 b1_ <- (b ) y1_ <- (y ) b2_ <- (b + Hydrogen) / 2 y2_ <- (y + Hydrogen) / 2 b3_ <- (b + 2 * Hydrogen) / 3 y3_ <- (y + 2 * Hydrogen) / 3 return( cbind(b1_, y1_, b2_, y2_, b3_, y3_) ) } peptideStd.ionLib <- genSwathIonLib(data=peptideStd, data.fit=peptideStd.redundant, fragmentIonFUN=myFragmentIon) summary(peptideStd.ionLib) idx<-40 op <- par(mfrow = c(2,1)) plot(peptideStd.ionLib) text(rt.input(peptideStd.ionLib)[idx], rt.normalized(peptideStd.ionLib)[idx], "X", cex=1.5) plot(ionlibrary(peptideStd.ionLib)[[idx]]) ## Not run: write.spectronaut(peptideStd.ionLib, file="peptideStd.ionLib.csv") ## End(Not run)
iRTpeptides data are used for genSwathIonLib rt normalization
assuming.
iRTpeptides first appear in the protViz 0.1.45 package.
It has been removed in protViz 0.2.10 to avoid package dependencies.
contains a table
Jonas Grossmann and Christian Panse 2013
Using iRT, a normalized retention time for more targeted measurement of peptides. Escher C, Reiter L, MacLean B, Ossola R, Herzog F, Chilton J, MacCoss MJ, Rinner O. Source Proteomics. 2012 Apr;12(8):1111-21. doi: 10.1002/pmic.201100463.
plot(sort(iRTpeptides$rt)) plot(pim<-protViz::parentIonMass(as.character(iRTpeptides$peptide)) ~ iRTpeptides$rt)plot(sort(iRTpeptides$rt)) plot(pim<-protViz::parentIonMass(as.character(iRTpeptides$peptide)) ~ iRTpeptides$rt)
ms1.p2069 contains 11830 peptide pre cursor m/z values of human proteins.
contains a numeric vector
Christian Panse
This dataset is a list of a peptide spectrum matches (protein identification result) from two standard runs.
contains a list of peptide spectrum assignments.
These standard runs (LCMS experiments) are routinely run on well maintained instruments. In this case a standard run consits of a digest of the FETUIN_BOVINE protein (400 amol) and iRT peptides.
Christian Panse, Christian Trachsel and Jonas Grossmann 2014
http://fgcz-data.uzh.ch/~cpanse/specL/data/
peakplot(peptideStd[[40]]$peptideSequence, peptideStd[[40]]) ## Not run: download.file("http://fgcz-data.uzh.ch/~cpanse/specL/data/peptideStd.blib", destfile="peptideStd.blib") download.file("http://fgcz-data.uzh.ch/~cpanse/specL/data/peptideStd.redundant.blib", destfile="peptideStd.redundant.blib") # checksum if (require(tools)){ md5sum(c("peptideStd.blib", "peptideStd.redundant.blib")) == c("3f231931e54efd6516d7aa302073b17f", "8bab829d9e99344136613a17c0374b90") } peptideStd <- read.bibliospec("peptideStd.blib") peptideStd.redundant <- read.bibliospec("peptideStd.redundant.blib") ## End(Not run)peakplot(peptideStd[[40]]$peptideSequence, peptideStd[[40]]) ## Not run: download.file("http://fgcz-data.uzh.ch/~cpanse/specL/data/peptideStd.blib", destfile="peptideStd.blib") download.file("http://fgcz-data.uzh.ch/~cpanse/specL/data/peptideStd.redundant.blib", destfile="peptideStd.redundant.blib") # checksum if (require(tools)){ md5sum(c("peptideStd.blib", "peptideStd.redundant.blib")) == c("3f231931e54efd6516d7aa302073b17f", "8bab829d9e99344136613a17c0374b90") } peptideStd <- read.bibliospec("peptideStd.blib") peptideStd.redundant <- read.bibliospec("peptideStd.redundant.blib") ## End(Not run)
plot in Package specL
This methode has no additional arguments.
The method plots on the current device.
signature(x = "specL")Plots the specL determined ions.
signature(x = "specLSet")Plots retention time versus retention time.
This function reads a BiblioSpec generated file and returns a list of tandem mass specs (psm objects), peptide assignments, retention times, and modifications records. The type of the data structire which is returned is called psmSet.
read.bibliospec(file)read.bibliospec(file)
file |
the name of the BiblioSpec generated SQLite file. |
The function performs a SQL query on the SQLite files generated by
bibliospec using the RSQLite package.
The function is required for generating spec libraries used
in a SWATH workflow.
BiblioSpec files are generated by using Skyline.
It returns a list which can be read by the genSwathIonLib
function and the protViz::peakplot function.
Christian Panse, 2014, 2015
https://skyline.gs.washington.edu/labkey/project/home/software/Skyline/begin.view
https://skyline.gs.washington.edu/labkey/project/home/software/BiblioSpec/begin.view
?SQLite
read.bibliospecread.bibliospec
show in Package specL ~~Methods for function show in package specL ~~
writes specL or specLSet objects to a file or console.
signature(x = "specL")Prints specL object data to the console.
signature(x = "specLSet")Prints specL object data to the console.
"specL"
This class is used to store, print, and plot the generated results of the package.
Objects can be created by calls of the form new("specL", ...).
group_id:Object of class "character" just an id
peptide_sequence:Object of class "character" AA
sequence
proteinInformation:Object of class "character" a
string contains the protein identifier.
q1:Object of class "numeric" peptide weight m/Z as
measured by the MS device
q1.in_silico:Object of class "numeric" peptide weight m/Z computed in-silico.
q3:Object of class "numeric" measured fragment ions.
q3.in_silico:Object of class "numeric" in-silico
derived fragment ions.
score:Object of class "numeric" taken from bibliospec - psm score
prec_z:Object of class "numeric" pre-cursor charge.
frg_type:Object of class "character" fragmenbt ion
type, e.g., b or y ion.
frg_nr:Object of class "numeric" fragment ion number
frg_z:Object of class "numeric" fragment ion charge.
relativeFragmentIntensity:Object of class "numeric"
percentage base peaks of frament ions.
irt:Object of class "numeric" independent retention
time in seconds.
peptideModSeq:Object of class "numeric" a vector
contains the mass diff between AA and mod AA.
mZ.error:Object of class "numeric" a string contains
the protein identifier.
filename:Object of class "character" a string contains
the filename of the ions.
signature(x = "specL"): plots the fragment ions of specL object.
signature(x = "specL"): shows the content of specL object.
signature(x = "specL"): writes the specL object to a ASCII file.
No notes yet.
Christian Panse 2014
showClass("specL")showClass("specL")
"specLSet"
This class is used to store, show, and write generated results of the package.
Objects can be created by calls of the form new("specLSet", ...).
input.parameter:A list of parameter values.
ionlibrary:A list of "specL" objects.
rt.normalized:A numeric vector of normalized retention time values.
rt.input:A numeric vector of retention time values.
signature(x = "specLSet"): shows the object content.
signature(x = "specLSet"): print summary of object content.
signature(x = "specLSet"): plots normalized versus input rt.
signature(x = "specLSet"): writes object to ASCII file.
signature(x = "specLSet"): generates consensus specLSet object by combining all specL objects having a redundant group_id which is defined by paste([email protected]_silico, x@peptideModSeq, sep='_').
signature(x = "specLSet"): merges two specLSet objects.
signature(x = "specLSet"): returns a list of specL objects.
signature(x = "specLSet"): returns a numeric vector of input rt values.
signature(x = "specLSet"): returns a numeric vector of normalized rt values.
signature(x = "specLSet"): returns table of peptide protein mappings.
No notes yet.
Christian Panse 2014
showClass("specL") showClass("specLSet")showClass("specL") showClass("specLSet")
write.spectronaut in Package specL
Methods for function write.spectronaut in package specL ~~
writes specL objects to a file in a format which can be read
by the 'Spectronaut' software.
additional arguments are
A file name. default is file='spec.txt'.
signature(x = "specL")Prints specL object data to to a file.
signature(x = "specLSet")Prints specL object data to to a file.