topdownr is free and open-source software. If you use it, please support the project by citing it in publications:
P.V. Shliaha, S. Gibb, V. Gorshkov, M.S. Jespersen, G.R. Andersen, D. Bailey, J. Schwartz, S. Eliuk, V. Schwämmle, and O.N. Jensen. 2018. Maximizing Sequence Coverage in Top-Down Proteomics By Automated Multi-modal Gas-phase Protein Fragmentation. Analytical Chemistry. DOI: 10.1021/acs.analchem.8b02344
For bugs, typos, suggestions or other questions, please file an issue
in our tracking system (https://github.com/sgibb/topdownr/issues) providing as
much information as possible, a reproducible example and the output of
sessionInfo().
If you don’t have a GitHub account or wish to reach a broader audience for general questions about proteomics analysis using R, you may want to use the Bioconductor support site: https://support.bioconductor.org/.
topdownrLoad the package.
Some example files are provided in the topdownrdata
package. For a full analysis you need a .fasta file with
the protein sequence, the .experiments.csv files containing
the method information, the .txt files containing the scan
header information and the .mzML files with the
deconvoluted spectra.
$csv
[1] ".../20170629_myo/experiments/myo_1211_ETDReagentTarget_1e6_1.experiments.csv.gz"
[2] ".../20170629_myo/experiments/myo_1211_ETDReagentTarget_1e6_2.experiments.csv.gz"
[3] "..."
$fasta
[1] ".../20170629_myo/fasta/myoglobin.fasta.gz"
[2] "..."
$mzML
[1] ".../20170629_myo/mzml/myo_1211_ETDReagentTarget_1e6_1.mzML.gz"
[2] ".../20170629_myo/mzml/myo_1211_ETDReagentTarget_1e6_2.mzML.gz"
[3] "..."
$txt
[1] ".../20170629_myo/header/myo_1211_ETDReagentTarget_1e6_1.txt.gz"
[2] ".../20170629_myo/header/myo_1211_ETDReagentTarget_1e6_2.txt.gz"
[3] "..."
All these files have to be in a directory. You could import them via
readTopDownFiles. This function has some arguments. The
most important ones are the path of the directory
containing the files, the protein modification
(e.g. initiator methionine removal, "Met-loss"), and
adducts (e.g. proton transfer often occurs from c to z-fragment after
ETD reaction).
## the mass adduct for a proton
H <- 1.0078250321
myoglobin <- readTopDownFiles(
## directory path
path = topdownrdata::topDownDataPath("myoglobin"),
## fragmentation types
type = c("a", "b", "c", "x", "y", "z"),
## adducts (add -H/H to c/z and name
## them cmH/zpH (c minus H, z plus H)
adducts = data.frame(
mass=c(-H, H),
to=c("c", "z"),
name=c("cmH", "zpH")),
## initiator methionine removal
modifications = "Met-loss",
## don't use neutral loss
neutralLoss = NULL,
## tolerance for fragment matching
tolerance = 5e-6,
## topdownrdata was generate with an older version of topdownr,
## the method files were generated with FilterString identification,
## use `conditions = "ScanDescription"` (default) for recent data.
conditions = "FilterString"
)## Warning in FUN(X[[i]], ...): 61 FilterString entries modified because of
## duplicated ID for different conditions.
## Warning in FUN(X[[i]], ...): 63 FilterString entries modified because of
## duplicated ID for different conditions.
## Warning in FUN(X[[i]], ...): 53 FilterString entries modified because of
## duplicated ID for different conditions.
## Warning in FUN(X[[i]], ...): 55 FilterString entries modified because of
## duplicated ID for different conditions.
## Warning in FUN(X[[i]], ...): 50 FilterString entries modified because of
## duplicated ID for different conditions.
## Warning in FUN(X[[i]], ...): 50 FilterString entries modified because of
## duplicated ID for different conditions.
## Warning in FUN(X[[i]], ...): ID in FilterString are not sorted in ascending
## order. Introduce own condition ID via 'cumsum'.
## Warning in FUN(X[[i]], ...): ID in FilterString are not sorted in ascending
## order. Introduce own condition ID via 'cumsum'.
## TopDownSet object (7.28 Mb)
## - - - Protein data - - -
## Amino acid sequence (153): GLSDGEWQQVLNVWGKVEADIAGHGQ...GAMTKALELFRNDIAAKYKELGFQG
## Mass : 16922.95
## Modifications (1): Met-loss
## - - - Fragment data - - -
## Number of theoretical fragments: 1216
## Theoretical fragment types (6): a, b, c, x, y, z
## Theoretical mass range: [30.03;16910.93]
## - - - Condition data - - -
## Number of conditions: 1852
## Number of scans: 5882
## Condition variables (66): File, Scan, ..., Sample, MedianIonInjectionTimeMs
## - - - Intensity data - - -
## Size of array: 1216x5882 (5.15% != 0)
## Number of matched fragments: 368296
## Intensity range: [87.61;10704001.00]
## - - - Processing information - - -
## [2026-07-23 05:34:39] 368296 fragments [1216;5882] matched (tolerance: 5 ppm, strategies ion/fragment: remove/remove).
## [2026-07-23 05:34:39] Condition names updated based on: Mz, AgcTarget, EtdReagentTarget, EtdActivation, CidActivation, HcdActivation. Order of conditions changed. 1852 conditions.
## [2026-07-23 05:34:39] Recalculate median injection time based on: Mz, AgcTarget.
TopDownSet AnatomyThe assembled object is an TopDownSet object. Briefly it
is composed of three interconnected tables:
rowViews/fragment data: holds the information
on the type of fragments, their modifications and adducts.colData/condition data: contains the
corresponding fragmentation condition for every spectrum.assayData: contains the intensity of assigned
fragments.This section explains the implementation details of the
TopDownSet class. It is not necessary to understand
everything written here to use topdownr for the analysis of
fragmentation data.
The TopDownSet contains the following components:
Fragment data, Condition data, Assay
data.
## FragmentViews on a 153-letter sequence:
## GLSDGEWQQVLNVWGKVEADIAGHGQEVLIRLFTGHPE...SKHPGDFGADAQGAMTKALELFRNDIAAKYKELGFQG
## Mass:
## 16922.95406
## Modifications:
## Met-loss
## Views:
## start end width mass name type z
## [1] 1 1 1 30.03 a1 a 1 [G]
## [2] 1 1 1 58.03 b1 b 1 [G]
## [3] 1 1 1 59.01 z1 z 1 [G]
## [4] 1 1 1 60.02 zpH1 z 1 [G]
## [5] 1 1 1 74.05 cmH1 c 1 [G]
## ... ... ... ... ... ... ... ... ...
## [1212] 2 153 152 16868.93 zpH152 z 1 [LSDGEWQQVLNVWG...DIAAKYKELGFQG]
## [1213] 1 152 152 16882.96 cmH152 c 1 [GLSDGEWQQVLNVW...NDIAAKYKELGFQ]
## [1214] 1 152 152 16883.97 c152 c 1 [GLSDGEWQQVLNVW...NDIAAKYKELGFQ]
## [1215] 2 153 152 16884.95 y152 y 1 [LSDGEWQQVLNVWG...DIAAKYKELGFQG]
## [1216] 2 153 152 16910.93 x152 x 1 [LSDGEWQQVLNVWG...DIAAKYKELGFQG]
The fragmentation data are represented by an
FragmentViews object that is an overloaded
XStringViews object. It contains one AAString
(the protein sequence) and an IRanges object that stores
the start, end (and width) values
of the fragments. Additionally it has a DataFrame for the
mass, type and z information of
each fragment.
## DataFrame with 5882 rows and 5 columns
## File Scan SpectrumIndex
## <Rle> <numeric> <integer>
## C0707.30_1.0e+05_1.0e+06_02.50_07_00_1 myo_707_ET... 33 22
## C0707.30_1.0e+05_1.0e+06_02.50_07_00_2 myo_707_ET... 34 23
## C0707.30_1.0e+05_1.0e+06_02.50_07_00_3 myo_707_ET... 33 23
## C0707.30_1.0e+05_1.0e+06_02.50_07_00_4 myo_707_ET... 34 24
## C0707.30_1.0e+05_1.0e+06_02.50_14_00_1 myo_707_ET... 36 25
## ... ... ... ...
## C1211.70_1.0e+06_0.0e+00_00.00_00_35_07 myo_1211_E... 223 203
## C1211.70_1.0e+06_0.0e+00_00.00_00_35_08 myo_1211_E... 221 202
## C1211.70_1.0e+06_0.0e+00_00.00_00_35_09 myo_1211_E... 222 203
## C1211.70_1.0e+06_0.0e+00_00.00_00_35_10 myo_1211_E... 223 203
## C1211.70_1.0e+06_0.0e+00_00.00_00_35_11 myo_1211_E... 224 204
## PeaksCount TotIonCurrent
## <integer> <numeric>
## C0707.30_1.0e+05_1.0e+06_02.50_07_00_1 161 27224937
## C0707.30_1.0e+05_1.0e+06_02.50_07_00_2 175 29167765
## C0707.30_1.0e+05_1.0e+06_02.50_07_00_3 180 26132872
## C0707.30_1.0e+05_1.0e+06_02.50_07_00_4 171 25475501
## C0707.30_1.0e+05_1.0e+06_02.50_14_00_1 172 27347105
## ... ... ...
## C1211.70_1.0e+06_0.0e+00_00.00_00_35_07 213 2566120
## C1211.70_1.0e+06_0.0e+00_00.00_00_35_08 250 2348707
## C1211.70_1.0e+06_0.0e+00_00.00_00_35_09 145 2305900
## C1211.70_1.0e+06_0.0e+00_00.00_00_35_10 207 2262800
## C1211.70_1.0e+06_0.0e+00_00.00_00_35_11 158 2212189
Condition data is a DataFrame that contains the combined
header information for each MS run (combined from method
(.experiments.csv files)/scan header (.txt
files) table and metadata from the .mzML files).
## 10 x 10 sparse Matrix of class "dgCMatrix"
## [[ suppressing 10 column names 'C0707.30_1.0e+05_1.0e+06_02.50_07_00_1', 'C0707.30_1.0e+05_1.0e+06_02.50_07_00_2', 'C0707.30_1.0e+05_1.0e+06_02.50_07_00_3' ... ]]
##
## z26 . . . . . . . .
## zpH26 491328.4 446301.1 407389.1 473200.9 470679.3 493244.8 390025.8 389430.25
## y26 . . . . . . . 23648.63
## b27 . . . . . . . .
## cmH27 . . . . . . . .
## c27 . . . . . . . .
## x26 . . . . . . . .
## z27 . . . . . . . .
## zpH27 534307.6 534135.1 434296.8 436866.2 550887.3 513038.8 460476.4 456524.97
## y27 . . . . . . . .
##
## z26 . .
## zpH26 496551.3 554295.7
## y26 . .
## b27 . .
## cmH27 . .
## c27 . .
## x26 . .
## z27 . .
## zpH27 602207.0 579989.8
## y27 . .
Assay data is a sparseMatrix from the
Matrix package (in detail a dgCMatrix) where
the rows correspond to the fragments, the columns to the runs/conditions
and the entries to the intensity values. A sparseMatrix is
similar to the classic matrix in R but stores just
the values that are different from zero.
TopDownSetA TopDownSet could be subsetted by the fragment and the
condition data.
## TopDownSet object (3.56 Mb)
## - - - Protein data - - -
## Amino acid sequence (153): GLSDGEWQQVLNVWGKVEADIAGHGQ...GAMTKALELFRNDIAAKYKELGFQG
## Mass : 16922.95
## Modifications (1): Met-loss
## - - - Fragment data - - -
## Number of theoretical fragments: 100
## Theoretical fragment types (6): a, b, c, x, y, z
## Theoretical mass range: [30.03;1426.70]
## - - - Condition data - - -
## Number of conditions: 1852
## Number of scans: 5882
## Condition variables (66): File, Scan, ..., Sample, MedianIonInjectionTimeMs
## - - - Intensity data - - -
## Size of array: 100x5882 (9.68% != 0)
## Number of matched fragments: 56955
## Intensity range: [105.70;1076768.00]
## - - - Processing information - - -
## [2026-07-23 05:34:39] 368296 fragments [1216;5882] matched (tolerance: 5 ppm, strategies ion/fragment: remove/remove).
## [2026-07-23 05:34:39] Condition names updated based on: Mz, AgcTarget, EtdReagentTarget, EtdActivation, CidActivation, HcdActivation. Order of conditions changed. 1852 conditions.
## [2026-07-23 05:34:39] Recalculate median injection time based on: Mz, AgcTarget.
## [2026-07-23 05:34:39] Subsetted 368296 fragments [1216;5882] to 56955 fragments [100;5882].
## TopDownSet object (4.51 Mb)
## - - - Protein data - - -
## Amino acid sequence (153): GLSDGEWQQVLNVWGKVEADIAGHGQ...GAMTKALELFRNDIAAKYKELGFQG
## Mass : 16922.95
## Modifications (1): Met-loss
## - - - Fragment data - - -
## Number of theoretical fragments: 304
## Theoretical fragment types (1): c
## Theoretical mass range: [74.05;16883.97]
## - - - Condition data - - -
## Number of conditions: 1852
## Number of scans: 5882
## Condition variables (66): File, Scan, ..., Sample, MedianIonInjectionTimeMs
## - - - Intensity data - - -
## Size of array: 304x5882 (7.69% != 0)
## Number of matched fragments: 137461
## Intensity range: [87.61;1203763.75]
## - - - Processing information - - -
## [2026-07-23 05:34:39] 368296 fragments [1216;5882] matched (tolerance: 5 ppm, strategies ion/fragment: remove/remove).
## [2026-07-23 05:34:39] Condition names updated based on: Mz, AgcTarget, EtdReagentTarget, EtdActivation, CidActivation, HcdActivation. Order of conditions changed. 1852 conditions.
## [2026-07-23 05:34:39] Recalculate median injection time based on: Mz, AgcTarget.
## [2026-07-23 05:34:39] Subsetted 368296 fragments [1216;5882] to 137461 fragments [304;5882].
## TopDownSet object (2.89 Mb)
## - - - Protein data - - -
## Amino acid sequence (153): GLSDGEWQQVLNVWGKVEADIAGHGQ...GAMTKALELFRNDIAAKYKELGFQG
## Mass : 16922.95
## Modifications (1): Met-loss
## - - - Fragment data - - -
## Number of theoretical fragments: 1
## Theoretical fragment types (1): c
## Theoretical mass range: [11085.96;11085.96]
## - - - Condition data - - -
## Number of conditions: 1852
## Number of scans: 5882
## Condition variables (66): File, Scan, ..., Sample, MedianIonInjectionTimeMs
## - - - Intensity data - - -
## Size of array: 1x5882 (0.09% != 0)
## Number of matched fragments: 5
## Intensity range: [1276.91;17056.12]
## - - - Processing information - - -
## [2026-07-23 05:34:39] 368296 fragments [1216;5882] matched (tolerance: 5 ppm, strategies ion/fragment: remove/remove).
## [2026-07-23 05:34:39] Condition names updated based on: Mz, AgcTarget, EtdReagentTarget, EtdActivation, CidActivation, HcdActivation. Order of conditions changed. 1852 conditions.
## [2026-07-23 05:34:39] Recalculate median injection time based on: Mz, AgcTarget.
## [2026-07-23 05:34:39] Subsetted 368296 fragments [1216;5882] to 5 fragments [1;5882].
# select all "a" and "b" fragments but just the first 100 "c"
myoglobin[c("a", "b", paste0("c", 1:100))]## TopDownSet object (4.59 Mb)
## - - - Protein data - - -
## Amino acid sequence (153): GLSDGEWQQVLNVWGKVEADIAGHGQ...GAMTKALELFRNDIAAKYKELGFQG
## Mass : 16922.95
## Modifications (1): Met-loss
## - - - Fragment data - - -
## Number of theoretical fragments: 404
## Theoretical fragment types (3): a, b, c
## Theoretical mass range: [30.03;16866.94]
## - - - Condition data - - -
## Number of conditions: 1852
## Number of scans: 5882
## Condition variables (66): File, Scan, ..., Sample, MedianIonInjectionTimeMs
## - - - Intensity data - - -
## Size of array: 404x5882 (6.04% != 0)
## Number of matched fragments: 143582
## Intensity range: [87.61;1630533.12]
## - - - Processing information - - -
## [2026-07-23 05:34:39] 368296 fragments [1216;5882] matched (tolerance: 5 ppm, strategies ion/fragment: remove/remove).
## [2026-07-23 05:34:39] Condition names updated based on: Mz, AgcTarget, EtdReagentTarget, EtdActivation, CidActivation, HcdActivation. Order of conditions changed. 1852 conditions.
## [2026-07-23 05:34:39] Recalculate median injection time based on: Mz, AgcTarget.
## [2026-07-23 05:34:39] Subsetted 368296 fragments [1216;5882] to 143582 fragments [404;5882].
## TopDownSet object (0.26 Mb)
## - - - Protein data - - -
## Amino acid sequence (153): GLSDGEWQQVLNVWGKVEADIAGHGQ...GAMTKALELFRNDIAAKYKELGFQG
## Mass : 16922.95
## Modifications (1): Met-loss
## - - - Fragment data - - -
## Number of theoretical fragments: 1216
## Theoretical fragment types (6): a, b, c, x, y, z
## Theoretical mass range: [30.03;16910.93]
## - - - Condition data - - -
## Number of conditions: 3
## Number of scans: 10
## Condition variables (66): File, Scan, ..., Sample, MedianIonInjectionTimeMs
## - - - Intensity data - - -
## Size of array: 1216x10 (8.38% != 0)
## Number of matched fragments: 1019
## Intensity range: [7872.05;1036892.19]
## - - - Processing information - - -
## [2026-07-23 05:34:39] 368296 fragments [1216;5882] matched (tolerance: 5 ppm, strategies ion/fragment: remove/remove).
## [2026-07-23 05:34:39] Condition names updated based on: Mz, AgcTarget, EtdReagentTarget, EtdActivation, CidActivation, HcdActivation. Order of conditions changed. 1852 conditions.
## [2026-07-23 05:34:39] Recalculate median injection time based on: Mz, AgcTarget.
## [2026-07-23 05:34:39] Subsetted 368296 fragments [1216;5882] to 1019 fragments [1216;10].
# select all conditions from one file
myoglobin[, myoglobin$File == "myo_1211_ETDReagentTarget_1e+06_1"]## TopDownSet object (0.24 Mb)
## - - - Protein data - - -
## Amino acid sequence (153): GLSDGEWQQVLNVWGKVEADIAGHGQ...GAMTKALELFRNDIAAKYKELGFQG
## Mass : 16922.95
## Modifications (1): Met-loss
## - - - Fragment data - - -
## Number of theoretical fragments: 1216
## Theoretical fragment types (6): a, b, c, x, y, z
## Theoretical mass range: [30.03;16910.93]
## - - - Processing information - - -
## [2026-07-23 05:34:39] 368296 fragments [1216;5882] matched (tolerance: 5 ppm, strategies ion/fragment: remove/remove).
## [2026-07-23 05:34:39] Condition names updated based on: Mz, AgcTarget, EtdReagentTarget, EtdActivation, CidActivation, HcdActivation. Order of conditions changed. 1852 conditions.
## [2026-07-23 05:34:39] Recalculate median injection time based on: Mz, AgcTarget.
## [2026-07-23 05:34:39] Subsetted 368296 fragments [1216;5882] to 0 fragments [1216;0].
# select all "c" fragments from a single file
myoglobin["c", myoglobin$File == "myo_1211_ETDReagentTarget_1e+06_1"]## TopDownSet object (0.11 Mb)
## - - - Protein data - - -
## Amino acid sequence (153): GLSDGEWQQVLNVWGKVEADIAGHGQ...GAMTKALELFRNDIAAKYKELGFQG
## Mass : 16922.95
## Modifications (1): Met-loss
## - - - Fragment data - - -
## Number of theoretical fragments: 304
## Theoretical fragment types (1): c
## Theoretical mass range: [74.05;16883.97]
## - - - Processing information - - -
## [2026-07-23 05:34:39] 368296 fragments [1216;5882] matched (tolerance: 5 ppm, strategies ion/fragment: remove/remove).
## [2026-07-23 05:34:39] Condition names updated based on: Mz, AgcTarget, EtdReagentTarget, EtdActivation, CidActivation, HcdActivation. Order of conditions changed. 1852 conditions.
## [2026-07-23 05:34:39] Recalculate median injection time based on: Mz, AgcTarget.
## [2026-07-23 05:34:39] Subsetted 368296 fragments [1216;5882] to 0 fragments [304;0].
TopDownSetEach condition represents one spectrum. We could plot a single
condition interactively or all spectra into a pdf file (or
any other R device that supports multiple pages/plots).
## [[1]]
## Warning: The `guide` argument in `scale_*()` cannot be `FALSE`. This was deprecated in
## ggplot2 3.3.4.
## ℹ Please use "none" instead.
## ℹ The deprecated feature was likely used in the topdownr package.
## Please report the issue at <https://codeberg.org/sgibb/topdownr/issues/>.
## This warning is displayed once per session.
## Call `lifecycle::last_lifecycle_warnings()` to see where this warning was
## generated.
## # example to plot the first ten conditions into a pdf
## # (not evaluated in the vignette)
## pdf("topdown-conditions.pdf", paper="a4r", width=12)
## plot(myoglobin[, 1:10])
## dev.off()plot returns a list (an item per condition)
of ggplot objects which could further modified or
investigated interactively by calling
plotly::ggplotly().
We follow the following workflow:
We use the example data loaded in Importing Files.
The data contains several replicates for each fragmentation condition. Before aggregation can be performed we need to remove scans with inadequate injection times and fragments with low intensity or poor intensity reproducibility.
Injection times should be consistent for a particular m/z
and particular AGC target. High or low injection times indicate problems
with on-the-flight AGC calculation or spray instability for a particular
scan. Hence the topdownr automatically calculates median
injection time for a given m/z and AGC target combination. The
user can choose to remove all scans that deviate more than a certain
amount from the corresponding median and/or choose to keep
N scans with the lowest deviation from the median for every
condition.
Here we show an example of such filtering and the effect on the distribution of injection times.
injTimeBefore <- colData(myoglobin)
injTimeBefore$Status <- "before filtering"
## filtering on max deviation and just keep the
## 2 technical replicates per condition with the
## lowest deviation
myoglobin <- filterInjectionTime(
myoglobin,
maxDeviation = log2(3),
keepTopN = 2
)
myoglobin## TopDownSet object (5.11 Mb)
## - - - Protein data - - -
## Amino acid sequence (153): GLSDGEWQQVLNVWGKVEADIAGHGQ...GAMTKALELFRNDIAAKYKELGFQG
## Mass : 16922.95
## Modifications (1): Met-loss
## - - - Fragment data - - -
## Number of theoretical fragments: 1216
## Theoretical fragment types (6): a, b, c, x, y, z
## Theoretical mass range: [30.03;16910.93]
## - - - Condition data - - -
## Number of conditions: 1852
## Number of scans: 3696
## Condition variables (66): File, Scan, ..., Sample, MedianIonInjectionTimeMs
## - - - Intensity data - - -
## Size of array: 1216x3696 (5.63% != 0)
## Number of matched fragments: 252897
## Intensity range: [109.29;8493567.00]
## - - - Processing information - - -
## [2026-07-23 05:34:39] 368296 fragments [1216;5882] matched (tolerance: 5 ppm, strategies ion/fragment: remove/remove).
## [2026-07-23 05:34:39] Condition names updated based on: Mz, AgcTarget, EtdReagentTarget, EtdActivation, CidActivation, HcdActivation. Order of conditions changed. 1852 conditions.
## [2026-07-23 05:34:39] Recalculate median injection time based on: Mz, AgcTarget.
## [2026-07-23 05:34:40] Subsetted 368296 fragments [1216;5882] to 252897 fragments [1216;3696].
## [2026-07-23 05:34:40] 2186 scans filtered with injection time deviation >= 1.58496250072116 or rank >= 3; 252897 fragments [1216;3696].
injTimeAfter <- colData(myoglobin)
injTimeAfter$Status <- "after filtering"
injTime <- as.data.frame(rbind(injTimeBefore, injTimeAfter))
## use ggplot for visualisation
library("ggplot2")
ggplot(injTime,
aes(x = as.factor(AgcTarget),
y = IonInjectionTimeMs,
group = AgcTarget)) +
geom_boxplot() +
facet_grid(Status ~ Mz)High CV of intensity for a fragment suggests either fragment contamination by another m/z species or problems with deisotoping and we recommend removing all fragments with CV > 30, as shown below.
## TopDownSet object (4.68 Mb)
## - - - Protein data - - -
## Amino acid sequence (153): GLSDGEWQQVLNVWGKVEADIAGHGQ...GAMTKALELFRNDIAAKYKELGFQG
## Mass : 16922.95
## Modifications (1): Met-loss
## - - - Fragment data - - -
## Number of theoretical fragments: 1216
## Theoretical fragment types (6): a, b, c, x, y, z
## Theoretical mass range: [30.03;16910.93]
## - - - Condition data - - -
## Number of conditions: 1852
## Number of scans: 3696
## Condition variables (66): File, Scan, ..., Sample, MedianIonInjectionTimeMs
## - - - Intensity data - - -
## Size of array: 1216x3696 (4.80% != 0)
## Number of matched fragments: 215569
## Intensity range: [109.29;8493567.00]
## - - - Processing information - - -
## [2026-07-23 05:34:39] 368296 fragments [1216;5882] matched (tolerance: 5 ppm, strategies ion/fragment: remove/remove).
## [2026-07-23 05:34:39] Condition names updated based on: Mz, AgcTarget, EtdReagentTarget, EtdActivation, CidActivation, HcdActivation. Order of conditions changed. 1852 conditions.
## [2026-07-23 05:34:39] Recalculate median injection time based on: Mz, AgcTarget.
## [2026-07-23 05:34:40] Subsetted 368296 fragments [1216;5882] to 252897 fragments [1216;3696].
## [2026-07-23 05:34:40] 2186 scans filtered with injection time deviation >= 1.58496250072116 or rank >= 3; 252897 fragments [1216;3696].
## [2026-07-23 05:34:42] 37328 fragments with CV > 30% filtered; 215569 fragments [1216;3696].
When optimizing protein fragmentation we also want to focus on the most intense fragments, hence we recommend removing all low intensity fragments from analysis.
Low intensity is defined relatively to the most intense observation
for this fragment (i.e. relatively to the maximum value in an
assayData row). In the example below all intensity values,
which have less than 10% intensity of the highest intensity to their
corresponding fragment (in their corresponding row) are removed.
## TopDownSet object (3.82 Mb)
## - - - Protein data - - -
## Amino acid sequence (153): GLSDGEWQQVLNVWGKVEADIAGHGQ...GAMTKALELFRNDIAAKYKELGFQG
## Mass : 16922.95
## Modifications (1): Met-loss
## - - - Fragment data - - -
## Number of theoretical fragments: 1216
## Theoretical fragment types (6): a, b, c, x, y, z
## Theoretical mass range: [30.03;16910.93]
## - - - Condition data - - -
## Number of conditions: 1852
## Number of scans: 3696
## Condition variables (66): File, Scan, ..., Sample, MedianIonInjectionTimeMs
## - - - Intensity data - - -
## Size of array: 1216x3696 (3.13% != 0)
## Number of matched fragments: 140483
## Intensity range: [219.52;8493567.00]
## - - - Processing information - - -
## [2026-07-23 05:34:39] 368296 fragments [1216;5882] matched (tolerance: 5 ppm, strategies ion/fragment: remove/remove).
## [2026-07-23 05:34:39] Condition names updated based on: Mz, AgcTarget, EtdReagentTarget, EtdActivation, CidActivation, HcdActivation. Order of conditions changed. 1852 conditions.
## [2026-07-23 05:34:39] Recalculate median injection time based on: Mz, AgcTarget.
## [2026-07-23 05:34:40] Subsetted 368296 fragments [1216;5882] to 252897 fragments [1216;3696].
## [2026-07-23 05:34:40] 2186 scans filtered with injection time deviation >= 1.58496250072116 or rank >= 3; 252897 fragments [1216;3696].
## [2026-07-23 05:34:42] 37328 fragments with CV > 30% filtered; 215569 fragments [1216;3696].
## [2026-07-23 05:34:42] 75086 intensity values < 0.1 (relative) filtered; 140483 fragments [1216;3696].
The next step of analysis is aggregating technical replicates of
fragmentation conditions (columns of assayData).
## TopDownSet object (2.25 Mb)
## - - - Protein data - - -
## Amino acid sequence (153): GLSDGEWQQVLNVWGKVEADIAGHGQ...GAMTKALELFRNDIAAKYKELGFQG
## Mass : 16922.95
## Modifications (1): Met-loss
## - - - Fragment data - - -
## Number of theoretical fragments: 1216
## Theoretical fragment types (6): a, b, c, x, y, z
## Theoretical mass range: [30.03;16910.93]
## - - - Condition data - - -
## Number of conditions: 1852
## Number of scans: 1852
## Condition variables (66): File, Scan, ..., Sample, MedianIonInjectionTimeMs
## - - - Intensity data - - -
## Size of array: 1216x1852 (3.96% != 0)
## Number of matched fragments: 89230
## Intensity range: [219.52;8492743.50]
## - - - Processing information - - -
## [2026-07-23 05:34:39] 368296 fragments [1216;5882] matched (tolerance: 5 ppm, strategies ion/fragment: remove/remove).
## [2026-07-23 05:34:39] Condition names updated based on: Mz, AgcTarget, EtdReagentTarget, EtdActivation, CidActivation, HcdActivation. Order of conditions changed. 1852 conditions.
## [2026-07-23 05:34:39] Recalculate median injection time based on: Mz, AgcTarget.
## [2026-07-23 05:34:40] Subsetted 368296 fragments [1216;5882] to 252897 fragments [1216;3696].
## [2026-07-23 05:34:40] 2186 scans filtered with injection time deviation >= 1.58496250072116 or rank >= 3; 252897 fragments [1216;3696].
## [2026-07-23 05:34:42] 37328 fragments with CV > 30% filtered; 215569 fragments [1216;3696].
## [2026-07-23 05:34:42] 75086 intensity values < 0.1 (relative) filtered; 140483 fragments [1216;3696].
## [2026-07-23 05:34:43] Aggregated 140483 fragments [1216;3696] to 89230 fragments [1216;1852].
To examine which of the features (fragmentation parameters) have the
highest overall impact for a protein we perform random forest machine
learning using the ranger (Wright
and Ziegler 2017) R-package.
Before we compute some fragmentation statistics (number of assigned fragments, total assigned intensity, etc.).
## Fragments Total Min Q1 Median Mean Q3 Max
## 1 114 20287547 15477.93 50676.35 117379.4 16683.84 284206.6 889160.9
## 2 112 20647046 9950.82 52033.36 130829.6 16979.48 280873.9 880548.7
## 3 107 21156793 7872.05 51000.28 137816.3 17398.68 299479.5 945866.1
## 4 112 20148236 13521.25 50698.44 118552.1 16569.27 280191.6 874603.0
## 5 113 19598593 11322.55 53494.00 113005.6 16117.26 272462.7 882041.0
## 6 110 19913901 15506.45 65573.98 119684.7 16376.56 265715.7 950459.8
## number of fragments
nFragments <- summary(myoglobin)$Fragments
## features of interest
foi <- c(
"AgcTarget",
"EtdReagentTarget",
"EtdActivation",
"CidActivation",
"HcdActivation",
"Charge"
)
rfTable <- as.data.frame(colData(myoglobin)[foi])
## set NA to zero
rfTable[is.na(rfTable)] <- 0
rfTable <- as.data.frame(cbind(
scale(rfTable),
Fragments = nFragments
))
featureImportance <- ranger(
Fragments ~ .,
data = rfTable,
importance = "impurity"
)$variable.importance
barplot(
featureImportance/sum(featureImportance),
cex.names = 0.7
)The two parameters having the lowest overall impact in the
myoglobin dataset across all conditions are ETD reagent
target (EtdReagentTarget), CID activation energy
(CidActivation) and AGC target (AgcTarget),
while ETD reaction energy (EtdActivation) and HCD
activation energy (HcdActivation) demonstrate the highest
overall impact.
The purpose of topdownr is to investigate how maximum
coverage with high intensity fragments can be achieved with minimal
instrument time. Therefore topdownr reports the best
combination of fragmentation conditions (with user specified number of
conditions) that covers the highest number of different bonds.
Different fragmentation methods predominantly generate different types of fragments (e.g. b and y for HCD and CID, c and z for ETD, a and x for UVPD).
However N-terminal (a, b and c) as well as C-terminal (x, y and z) fragments originating from the same bond, cover the same number of amino acid sidechains. Hence different types of N-terminal (a, b and c) or C-terminal (x, y and z) fragments from the same bond add no extra sequence information.
Before we compute combinations all the fragments are converted to either N- or C-terminal, as shown in the image below.
In topdownr we convert the TopDownSet into
an NCBSet object
(N-terminal/C-terminal/Bidirectional).
## NCBSet object (2.07 Mb)
## - - - Protein data - - -
## Amino acid sequence (153): GLSDGEWQQVLNVWGKVEADIAGHGQ...GAMTKALELFRNDIAAKYKELGFQG
## - - - Fragment data - - -
## Number of N-terminal fragments: 30592
## Number of C-terminal fragments: 29456
## Number of N- and C-terminal fragments: 9506
## - - - Condition data - - -
## Number of conditions: 1852
## Number of scans: 1852
## Condition variables (67): File, Scan, ..., MedianIonInjectionTimeMs, AssignedIntensity
## - - - Assay data - - -
## Size of array: 152x1852 (24.71% != 0)
## - - - Processing information - - -
## [2026-07-23 05:34:39] 368296 fragments [1216;5882] matched (tolerance: 5 ppm, strategies ion/fragment: remove/remove).
## [2026-07-23 05:34:39] Condition names updated based on: Mz, AgcTarget, EtdReagentTarget, EtdActivation, CidActivation, HcdActivation. Order of conditions changed. 1852 conditions.
## [2026-07-23 05:34:39] Recalculate median injection time based on: Mz, AgcTarget.
## [2026-07-23 05:34:40] Subsetted 368296 fragments [1216;5882] to 252897 fragments [1216;3696].
## [2026-07-23 05:34:40] 2186 scans filtered with injection time deviation >= 1.58496250072116 or rank >= 3; 252897 fragments [1216;3696].
## [2026-07-23 05:34:42] 37328 fragments with CV > 30% filtered; 215569 fragments [1216;3696].
## [2026-07-23 05:34:42] 75086 intensity values < 0.1 (relative) filtered; 140483 fragments [1216;3696].
## [2026-07-23 05:34:43] Aggregated 140483 fragments [1216;3696] to 89230 fragments [1216;1852].
## [2026-07-23 05:34:44] Coerced TopDownSet into an NCBSet object; 69554 fragments [152;1852].
An NCBSet is very similar to a TopDownSet
but instead of an FragmentViews the rowViews
are an XStringViews for the former. Another difference is
that the NCBSet has one row per bond instead one row per
fragment. Also the assayData contains no intensity
information but a 1 for an N-terminal, a
2 for a C-terminal and a 3 for
bidirectional fragments.
The NCBSet can be used to select the combination of
conditions that provide the best fragment coverage. While computing
coverage topdownr awards 1 point for every fragment going
from every bond in either N or C directions. This
means that bonds covered in both directions increase the score of a
condition by 2 points. For the myoglobin fragmentation example we get
the following table for the best three conditions:
## Index FragmentsAddedToCombination
## C0893.10_1.0e+06_1.0e+06_05.00_14_00_1 1049 143
## C1211.70_1.0e+05_0.0e+00_00.00_28_00_05 1431 62
## C0707.30_5.0e+05_5.0e+06_02.50_07_00_1 275 28
## BondsAddedToCombination
## C0893.10_1.0e+06_1.0e+06_05.00_14_00_1 98
## C1211.70_1.0e+05_0.0e+00_00.00_28_00_05 36
## C0707.30_5.0e+05_5.0e+06_02.50_07_00_1 10
## FragmentsInCondition BondsInCondition
## C0893.10_1.0e+06_1.0e+06_05.00_14_00_1 143 98
## C1211.70_1.0e+05_0.0e+00_00.00_28_00_05 108 82
## C0707.30_5.0e+05_5.0e+06_02.50_07_00_1 132 97
## FragmentCoverage BondCoverage
## C0893.10_1.0e+06_1.0e+06_05.00_14_00_1 0.4703947 0.6447368
## C1211.70_1.0e+05_0.0e+00_00.00_28_00_05 0.6743421 0.8815789
## C0707.30_5.0e+05_5.0e+06_02.50_07_00_1 0.7664474 0.9473684
Fragmentation maps allow visualising the type of fragments produced
by fragmentation conditions and their overall distribution along the
protein backbone. It also illustrates how the combination of conditions
results in a cumulative increase in fragment coverage. Shown below is a
fragmentation map for myoglobin m/z 707.3, AGC target
1e6 and ETD reagent target of 1e7 for ETD
(plotting more conditions is not practical for the vignette):
sel <-
myoglobinNcb$Mz == 707.3 &
myoglobinNcb$AgcTarget == 1e6 &
(myoglobinNcb$EtdReagentTarget == 1e7 &
!is.na(myoglobinNcb$EtdReagentTarget))
myoglobinNcbSub <- myoglobinNcb[, sel]
fragmentationMap(
myoglobinNcbSub,
nCombinations = 10,
labels = seq_len(ncol(myoglobinNcbSub))
)## R version 4.6.1 (2026-06-24)
## Platform: x86_64-pc-linux-gnu
## Running under: Ubuntu 26.04 LTS
##
## Matrix products: default
## BLAS: /usr/lib/x86_64-linux-gnu/openblas-pthread/libblas.so.3
## LAPACK: /usr/lib/x86_64-linux-gnu/openblas-pthread/libopenblasp-r0.3.32.so; LAPACK version 3.12.0
##
## locale:
## [1] LC_CTYPE=en_US.UTF-8 LC_NUMERIC=C
## [3] LC_TIME=en_US.UTF-8 LC_COLLATE=en_US.UTF-8
## [5] LC_MONETARY=en_US.UTF-8 LC_MESSAGES=en_US.UTF-8
## [7] LC_PAPER=en_US.UTF-8 LC_NAME=C
## [9] LC_ADDRESS=C LC_TELEPHONE=C
## [11] LC_MEASUREMENT=en_US.UTF-8 LC_IDENTIFICATION=C
##
## time zone: Etc/UTC
## tzcode source: system (glibc)
##
## attached base packages:
## [1] stats4 stats graphics grDevices utils datasets methods
## [8] base
##
## other attached packages:
## [1] ggplot2_4.0.3 ranger_0.18.0 topdownrdata_1.34.0
## [4] topdownr_1.34.0 Biostrings_2.80.1 Seqinfo_1.2.0
## [7] XVector_0.52.0 IRanges_2.46.0 S4Vectors_0.50.1
## [10] ProtGenerics_1.44.0 BiocGenerics_0.58.1 generics_0.1.4
## [13] BiocStyle_2.40.0
##
## loaded via a namespace (and not attached):
## [1] rlang_1.3.0 magrittr_2.0.5
## [3] clue_0.3-68 otel_0.2.0
## [5] matrixStats_1.5.0 compiler_4.6.1
## [7] PTMods_1.0.0 vctrs_0.7.3
## [9] reshape2_1.4.5 stringr_1.6.0
## [11] pkgconfig_2.0.3 MetaboCoreUtils_1.20.1
## [13] crayon_1.5.3 fastmap_1.2.0
## [15] labeling_0.4.3 rmarkdown_2.31
## [17] preprocessCore_1.74.0 purrr_1.2.2
## [19] xfun_0.60 MultiAssayExperiment_1.38.0
## [21] cachem_1.1.0 jsonlite_2.0.0
## [23] DelayedArray_0.38.2 BiocParallel_1.46.0
## [25] parallel_4.6.1 cluster_2.1.8.2
## [27] R6_2.6.1 bslib_0.11.0
## [29] stringi_1.8.7 RColorBrewer_1.1-3
## [31] limma_3.68.4 GenomicRanges_1.64.0
## [33] jquerylib_0.1.4 Rcpp_1.1.2
## [35] SummarizedExperiment_1.42.0 iterators_1.0.14
## [37] knitr_1.51 Matrix_1.7-5
## [39] igraph_2.3.3 tidyselect_1.2.1
## [41] abind_1.4-8 yaml_2.3.12
## [43] doParallel_1.0.17 codetools_0.2-20
## [45] affy_1.90.0 lattice_0.22-9
## [47] tibble_3.3.1 plyr_1.8.9
## [49] Biobase_2.72.0 withr_3.0.3
## [51] S7_0.2.2 evaluate_1.0.5
## [53] Spectra_1.22.2 pillar_1.11.1
## [55] affyio_1.82.0 BiocManager_1.30.27
## [57] MatrixGenerics_1.24.0 foreach_1.5.2
## [59] MSnbase_2.38.0 MALDIquant_1.22.3
## [61] ncdf4_1.24 scales_1.4.0
## [63] glue_1.8.1 lazyeval_0.2.3
## [65] maketools_1.3.2 tools_4.6.1
## [67] mzID_1.50.0 sys_3.4.3
## [69] data.table_1.18.4 QFeatures_1.22.0
## [71] vsn_3.80.0 mzR_2.46.0
## [73] buildtools_1.0.0 fs_2.1.0
## [75] XML_3.99-0.23 grid_4.6.1
## [77] impute_1.86.0 tidyr_1.3.2
## [79] MsCoreUtils_1.24.0 PSMatch_1.16.0
## [81] cli_3.6.6 S4Arrays_1.12.0
## [83] dplyr_1.2.1 AnnotationFilter_1.36.0
## [85] pcaMethods_2.4.0 gtable_0.3.6
## [87] sass_0.4.10 digest_0.6.39
## [89] SparseArray_1.12.2 farver_2.1.2
## [91] htmltools_0.5.9 lifecycle_1.0.5
## [93] statmod_1.5.2 MASS_7.3-66